PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_3123g0020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family LBD
Protein Properties Length: 180aa    MW: 19875.7 Da    PI: 4.4609
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_3123g0020genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260446.2e-142504896
        DUF260 48 alpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96
                  +lp +er d+++s+ y+A+ar++dPvyG+v++i++lq+q+++lk +la+
  MA_3123g0020  2 HLPVQERYDTVASVSYQAQARLQDPVYGCVSHIFALQHQVANLKGKLAV 50
                  678999*************************************999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508918.692155IPR004883Lateral organ boundaries, LOB
PfamPF031955.5E-12349IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MHLPVQERYD TVASVSYQAQ ARLQDPVYGC VSHIFALQHQ VANLKGKLAV GYAQLAACSS  60
SDGASLTSEY GYGKQSEMPS LISNSNSSSP YDPQYLNPWG DLQSIPSENV AVNNYDEEAR  120
EDECSWGSFS VCTKGVIHPP STAQETDVFR DAERFSEQFH PNNYRDGDLQ DLASALLRRS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03760.12e-17LOB domain-containing protein 20