PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_292200g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family LBD
Protein Properties Length: 167aa    MW: 18981.7 Da    PI: 7.0528
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_292200g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601223.2e-3861051100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +C aCk+ r+kC+++Cvlapyfp ++++kf  vh++FG+ +++kll++l+ e+r da+ss+vyeA+ r rdPv+G+vgvi++l++++ +l+a+l+
  MA_292200g0010   6 PCGACKIYRKKCSEKCVLAPYFPLDDRQKFLLVHRVFGRGHIIKLLRDLQAEQRGDAVSSMVYEANQRDRDPVHGCVGVINDLHRRVTELQAKLD 100
                     7*********************************************************************************************9 PP

          DUF260  96 llkee 100
                     + +++
  MA_292200g0010 101 SKQAQ 105
                     99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.2455106IPR004883Lateral organ boundaries, LOB
PfamPF031952.5E-376103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MRSTLPCGAC KIYRKKCSEK CVLAPYFPLD DRQKFLLVHR VFGRGHIIKL LRDLQAEQRG  60
DAVSSMVYEA NQRDRDPVHG CVGVINDLHR RVTELQAKLD SKQAQLADMS MQHAHLLDLA  120
TNLVTNYHEA LVTHIYDASL QVSEGTHTDP HVLDDLDPKQ LWEPLST
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-34612511130LOB family transfactor Ramosa2.1
5ly0_B7e-34612511130LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1144430.0BT114443.1 Picea glauca clone GQ03514_J12 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ9LQR06e-44LBD1_ARATH; LOB domain-containing protein 1
SwissprotQ9SK081e-43LBD11_ARATH; LOB domain-containing protein 11
TrEMBLB8LQI92e-66B8LQI9_PICSI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.12e-46LOB domain-containing protein 1