PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_290245g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family LBD
Protein Properties Length: 224aa    MW: 24598.8 Da    PI: 7.8732
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_290245g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260145.21.9e-4581071100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrrkC+ +Cv+apyfp +qp+kfanvhk+FGasnv+kll++l++++reda++sl+yeA+ar++dPvyG+vg i+ lq+q++ql++el+
  MA_290245g0010   8 PCAACKFLRRKCTLECVFAPYFPPDQPQKFANVHKIFGASNVTKLLNELHPHQREDAVNSLAYEADARVKDPVYGCVGAISILQHQVKQLQTELH 102
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  MA_290245g0010 103 HARSE 107
                     99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.4567108IPR004883Lateral organ boundaries, LOB
PfamPF031952.0E-448105IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MASSSNSPCA ACKFLRRKCT LECVFAPYFP PDQPQKFANV HKIFGASNVT KLLNELHPHQ  60
REDAVNSLAY EADARVKDPV YGCVGAISIL QHQVKQLQTE LHHARSELSK YINAGIAIPP  120
MGVAPGIGMG LAGSSRDQIF RDQNIIESHI SRDHILRASN YDQTDIVRLS GPGYDPNYLA  180
ISGSLAQAQA QAQAQVFNPY PRTGSSSDER ACISPPYLHP KREE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-5741117114LOB family transfactor Ramosa2.1
5ly0_B1e-5741117114LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1195420.0BT119542.1 Picea glauca clone GQ04106_O21 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024403438.13e-70LOB domain-containing protein 6-like
TrEMBLA0A443NSI22e-73A0A443NSI2_9MAGN; LOB domain-containing protein 6-like protein
STRINGPP1S170_78V6.11e-69(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.42e-59LBD family protein