PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_276627g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family LBD
Protein Properties Length: 255aa    MW: 28767.2 Da    PI: 5.4362
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_276627g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26033.71e-102415897
          DUF260 58 msslvyeAearardPvyGavgvilklqqqleqlkaelall 97
                    ++sl+yeA+ r+ +P yG+vg++++++++++q+++e +l 
  MA_276627g0010  2 FRSLLYEACGRIVNPTYGSVGLLWSGNWHICQAAVESVLK 41
                    89********************************998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031951.1E-6238IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
IFRSLLYEAC GRIVNPTYGS VGLLWSGNWH ICQAAVESVL KGYPLQPLNL LEIGSPPAAA  60
AAAAAPQSME TVADKLRNVK SQGRFKRPLY RKPSTDIKQL NLHALKDEEA EGSLAGSQVY  120
NLRWRRCYPK EFQLINVEPA TNFLSTDSSS DSDDLARLKT GFENVKFNCN PVEYRETRDQ  180
SEGIENQSED PLQNLFQQND NYEVENIMRA ELTDEKNLEL ELTLGSSMSE TTHTHRKQLG  240
RNCMDRSPLR LSLSQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67100.18e-25LOB domain-containing protein 40