PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_234967g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family LBD
Protein Properties Length: 212aa    MW: 24030.6 Da    PI: 7.2496
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_234967g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260132.22e-41551541100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk++r+kC+k+Cvlapyfp+++p+kf+ vh+lFG+ +v+k+l++lp e+r da++s+vyeA  r+rdPv+G+v+vi++lq+++++l+++la
  MA_234967g0010  55 PCAACKIQRKKCTKKCVLAPYFPQDDPEKFRLVHRLFGNGHVVKILQDLPAEQRGDAVRSMVYEASERIRDPVHGCVRVINDLQKKVAELQSQLA 149
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     l+++e
  MA_234967g0010 150 LTQAE 154
                     99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.30354155IPR004883Lateral organ boundaries, LOB
PfamPF031953.5E-4055152IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MTMFHMISYL ILPQEGFLFA CNSPRKLDLH TATERIVLQM SGVTASKPEG SSRTPCAACK  60
IQRKKCTKKC VLAPYFPQDD PEKFRLVHRL FGNGHVVKIL QDLPAEQRGD AVRSMVYEAS  120
ERIRDPVHGC VRVINDLQKK VAELQSQLAL TQAEVANISQ EHANLLTIIT GSHEPSDPNF  180
YYASPQHSVD TDMNQPVLQY VDHLPLWELF WT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-32511557111LOB family transfactor Ramosa2.1
5ly0_B1e-32511557111LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008363479.13e-50LOB domain-containing protein 1-like
SwissprotQ9LQR02e-44LBD1_ARATH; LOB domain-containing protein 1
TrEMBLB8LQI96e-71B8LQI9_PICSI; Uncharacterized protein
STRINGXP_008358286.11e-49(Malus domestica)
STRINGXP_008363479.11e-49(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.19e-47LOB domain-containing protein 1