PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_21460g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family HD-ZIP
Protein Properties Length: 200aa    MW: 22761.1 Da    PI: 10.4549
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_21460g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.13.1e-1885139256
                    T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    +k+ +++k+q   L+e F k+++p  ++++ LA++l+L ++qVkvWFqNrRa+ k
  MA_21460g0010  85 KKKVRLSKDQWALLQESFSKDSTPELNQKKALARQLNLRTKQVKVWFQNRRARTK 139
                    78999************************************************98 PP

2HD-ZIP_I/II99.43.4e-3285173190
    HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                    +kk rlsk+q +lL esF+++++ e ++K++lar+L+l+++qv+vWFqnrRARtk+kq+E+dye Lkr+ ++l++en++L+ke +eLr +
  MA_21460g0010  85 KKKVRLSKDQWALLQESFSKDSTPELNQKKALARQLNLRTKQVKVWFQNRRARTKLKQTEMDYELLKRCNESLTDENRKLQKELQELR-S 173
                    599************************************************************************************9.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.0E-1773139IPR009057Homeodomain-like
PROSITE profilePS5007116.92581141IPR001356Homeobox domain
SuperFamilySSF466893.08E-1783149IPR009057Homeodomain-like
SMARTSM003892.3E-1283145IPR001356Homeobox domain
PfamPF000461.2E-1585139IPR001356Homeobox domain
CDDcd000867.88E-1285142No hitNo description
PROSITE patternPS000270116139IPR017970Homeobox, conserved site
SMARTSM003403.0E-19141184IPR003106Leucine zipper, homeobox-associated
PfamPF021836.3E-8141174IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MDAIRPVPVS RRFDVNKFPP SCYSNKEASA INVSSSNSTV DSNAINSKSG YAMDSKRKLV  60
ATQELDHERA CSRVLSDVKE KGRAKKKVRL SKDQWALLQE SFSKDSTPEL NQKKALARQL  120
NLRTKQVKVW FQNRRARTKL KQTEMDYELL KRCNESLTDE NRKLQKELQE LRSLKLASPL  180
LPATTLTVCP CCETVASARQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1133141RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_026427318.12e-55homeobox-leucine zipper protein HOX11-like isoform X1
RefseqXP_026427319.12e-55homeobox-leucine zipper protein HOX11-like isoform X2
SwissprotQ67UE27e-50HOX11_ORYSJ; Homeobox-leucine zipper protein HOX11
TrEMBLA9NKN42e-69A9NKN4_PICSI; Uncharacterized protein
STRINGXP_010053507.11e-53(Eucalyptus grandis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.15e-37homeobox from Arabidopsis thaliana