PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_2101g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family TCP
Protein Properties Length: 477aa    MW: 51704.3 Da    PI: 6.7642
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_2101g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP116.24.3e-36142212373
           TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                   +kk++ +++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++ti+WLlqqa+p+i ++tgt++++as++
  MA_2101g0010 142 KKKSSCKDRHTKVDGRGRRIRMPATCAARIFQLTKELGHKSDGETIQWLLQQAEPSIMAATGTGTIPASAA 212
                   699999***********************************************************999665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036344.9E-31146253IPR005333Transcription factor, TCP
PROSITE profilePS5136925.879147201IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 477 aa     Download sequence    Send to blast
MANLLTSGYT SIFIVSFGVT LQAAAIFVYK TLLGVQTSGF LCFYISIIQQ AFVIVYSCLR  60
VYPADETEQR DNSYGADTEQ GLRGSTESYV KAMHAAMDAE RIALGSSSMA IAEDLETISG  120
TPIPSSSTGS DLQGTNQQGI VKKKSSCKDR HTKVDGRGRR IRMPATCAAR IFQLTKELGH  180
KSDGETIQWL LQQAEPSIMA ATGTGTIPAS AAAMAGSIGE SGNVLTDSPH GLLGLTVRVC  240
GGDMIMDHLE RRSLMQGARG HEVGRFQNEG FVDQGLEMRR LSDQGLEMRR LREEKGIQLG  300
HMQQNAELSE RRLGVLSAAS RHFSMQESPS EGLSQIWTDS SMYRMTPVPP PPASAASIQA  360
GSRNLTCSNP MTPLTTYMLP SAMNRMPGIN LSGLELQSGH MGHMPLSAML QQQQQGSHPE  420
HHLLGVQAGE GQIGIIASSS AYNNSVRSIT EDYLHHHHHL HYPHAASGQD NSYDQNQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00636PBMTransfer from Glyma.19G095300Download
Motif logo
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9221459
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58100.17e-39TCP family protein