PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_20537g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family SBP
Protein Properties Length: 461aa    MW: 50416.2 Da    PI: 8.7818
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_20537g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP126.51.1e-39151228178
                    --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
            SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                    +Cq+egC+a+ls+ak+yhrrhkvCe hska++v+v+g  qrfCqqCsrfh  sefDe+krsCr+rLa+hn+rrrk+q+
  MA_20537g0010 151 QCQAEGCKANLSSAKHYHRRHKVCELHSKASTVVVAGFIQRFCQQCSRFHPRSEFDEGKRSCRKRLADHNRRRRKPQP 228
                    5**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.2E-32145213IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.778149226IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.31E-37150230IPR004333Transcription factor, SBP-box
PfamPF031106.2E-30152225IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 461 aa     Download sequence    Send to blast
MQTSRPDTRS WMSSHNSDQP KPRNLMTTSQ LVQGSPASAL SRNSAAFFDS PGLHGQDQFV  60
DPCSMWRLGC SSDQTTLEQP HGVIEKRGQL VHGCYFVKAE EELDFFQARM ALNLAGAGTT  120
TYSGGASQET GHGNRFCRTG ISSCAGSQIP QCQAEGCKAN LSSAKHYHRR HKVCELHSKA  180
STVVVAGFIQ RFCQQCSRFH PRSEFDEGKR SCRKRLADHN RRRRKPQPNP CTASQCQAGT  240
SGLQIENQKT KGSPGHNTTG VQITPNINTS TSTTPSLISS VPMMMFPNTY KGQIPVLQGT  300
SNDKKSCVEF LYASIAQTGS DLSLEGRIVS DNQIDSSEYE LLQPCSLRSG LLGSEITGRF  360
SRPAPVDIQY SQSHISMKNS NSNLRVIESS KSSLNLKIFS TSNDTPAALS SMKNGGSNWI  420
LNGSSAEGVR TYDKIHESAQ STRSAYDPTP RNDAIIKWDE V
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-28147225684squamosa promoter binding protein-like 4
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1208225KRSCRKRLADHNRRRRKP
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1100430.0BT110043.1 Picea glauca clone GQ03215_D14 mRNA sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.14e-42squamosa promoter binding protein-like 8