PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_19975g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family LBD
Protein Properties Length: 163aa    MW: 18209.8 Da    PI: 5.7762
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_19975g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260130.66.8e-41111101100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    aCaaCk++++kC+++Cvlapyfp+++ kkf  vh+lFG  +v+kll++lp e+r da+sslvyeA+ar++dPv+G++gvi++lq++le+++ +l++
  MA_19975g0010  11 ACAACKFQKKKCSDKCVLAPYFPQKDLKKFLLVHRLFGYGHVVKLLQDLPAEQRADAVSSLVYEAKARVKDPVNGCTGVISDLQKKLEEVQLQLVS 106
                    7*******************************************************************************************9999 PP

         DUF260  97 lkee 100
                     ++e
  MA_19975g0010 107 KQAE 110
                    8876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.64310111IPR004883Lateral organ boundaries, LOB
PfamPF031954.5E-3911108IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MASQVSKPES ACAACKFQKK KCSDKCVLAP YFPQKDLKKF LLVHRLFGYG HVVKLLQDLP  60
AEQRADAVSS LVYEAKARVK DPVNGCTGVI SDLQKKLEEV QLQLVSKQAE LANISLLTVV  120
TGYDPNFYSA SQQESQDTQY TNPQVFDDDI VDPLPLWEPS IWS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-341211112111LOB family transfactor Ramosa2.1
5ly0_B3e-341211112111LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB8LQI94e-59B8LQI9_PICSI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.19e-28LOB domain-containing protein 11