PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_194299g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family HD-ZIP
Protein Properties Length: 264aa    MW: 30120.3 Da    PI: 7.7221
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_194299g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox49.38.4e-16119172256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ +++k+q   Lee F+++++++ ++  +LA++l+L+ rqV vWFqNrRa+ k
  MA_194299g0010 119 RKKLRLSKDQSALLEESFRQHSTLNPQK-LDLAQRLNLSLRQVEVWFQNRRARTK 172
                     677889******************9876.58**********************98 PP

2HD-ZIP_I/II111.65.3e-36119207191
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                     +kk+rlsk+q++lLEesF+++++L+p +K +la++L+l+ rqv+vWFqnrRARtk+kq+E+d+e+Lkr++d+l+een++L+ke  eLr +l
  MA_194299g0010 119 RKKLRLSKDQSALLEESFRQHSTLNP-QKLDLAQRLNLSLRQVEVWFQNRRARTKLKQTEVDCEFLKRCCDNLTEENRKLKKELYELR-AL 207
                     69***********************9.69**********************************************************9.44 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.44E-15113175IPR009057Homeodomain-like
PROSITE profilePS5007113.783115174IPR001356Homeobox domain
SMARTSM003899.5E-14117178IPR001356Homeobox domain
CDDcd000865.48E-14119175No hitNo description
PfamPF000463.0E-13119172IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.4E-14119177IPR009057Homeodomain-like
PROSITE patternPS000270149172IPR017970Homeobox, conserved site
SMARTSM003402.6E-22174217IPR003106Leucine zipper, homeobox-associated
PfamPF021834.2E-10174208IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MEFWQRECNT RLGLGRDLSV EDEAVKHSIN NVPVQLDLLP LRPVPLNSIA PPESQRAIDV  60
NQVPLCDHAL LSSPNSTLSM SMFHLDPYIY NTNASKQETL EMVAERASDE EEGTASTCRK  120
KLRLSKDQSA LLEESFRQHS TLNPQKLDLA QRLNLSLRQV EVWFQNRRAR TKLKQTEVDC  180
EFLKRCCDNL TEENRKLKKE LYELRALKVE SPFYMQLPAA TLSMCPSCER VVTTDHNINT  240
PKSQLALISS NPSTRKLSQP SARP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1166174RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_026427319.11e-75homeobox-leucine zipper protein HOX11-like isoform X2
SwissprotA2YW031e-62HOX27_ORYSI; Homeobox-leucine zipper protein HOX27
TrEMBLA0A0C9QME45e-76A0A0C9QME4_9SPER; TSA: Wollemia nobilis Ref_Wollemi_Transcript_22371_1708 transcribed RNA sequence
STRINGEOY095243e-73(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.11e-64homeobox from Arabidopsis thaliana