PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_18267g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family Dof
Protein Properties Length: 449aa    MW: 49875.1 Da    PI: 8.0846
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_18267g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.51.6e-3978138262
         zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                    +++alkcprCds+ntkfCyynnyslsqPr+fCk+C+ryWt+GG+lrnvPvGgg+rknk+++
  MA_18267g0010  78 PDQALKCPRCDSANTKFCYYNNYSLSQPRHFCKTCKRYWTRGGTLRNVPVGGGCRKNKRAK 138
                    6899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-2875136IPR003851Zinc finger, Dof-type
PfamPF027011.2E-3379136IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.41382136IPR003851Zinc finger, Dof-type
PROSITE patternPS01361084120IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 449 aa     Download sequence    Send to blast
MLLKPQTPIS ILRDLFIRCF HLGVQLGETL QGCSVQVCMD SDWPQGVMHE RTLKPLEEIL  60
PACSRPMMEQ SGLKPPPPDQ ALKCPRCDSA NTKFCYYNNY SLSQPRHFCK TCKRYWTRGG  120
TLRNVPVGGG CRKNKRAKRT IDHGCAQMNE ASTSVNDLNI NGSAPLGHSQ MTNSMFYGLP  180
TGSAATHDGI HSLSLARRLV DQRALYGNDS EFLRTFFDPR SCNLSPLNGL SSLNTLNSFK  240
STFPGLNFNS NPNRTEALTR TVRDIDGSFF ESLPTQISEV SLPVLNSTNC DDLSPFALSL  300
HEGINGNTNR YSEANQWRSS EQQKLAEASD HVQVGLTPFS ELENSNSSRI DHNRKVVTSL  360
PSCVKVEGQD NRLNITSEWP VPSESLFDAA SDSAYWNGGV WPELTTYGSS NMLFVSGVMK  420
FGIDRSDGRR RLKLSGPSFV PVNGYRFYS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00407DAPTransfer from AT3G55370Download
Motif logo
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.12e-35TARGET OF MONOPTEROS 6