PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_175298g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family Dof
Protein Properties Length: 545aa    MW: 58463.8 Da    PI: 5.9325
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_175298g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.58.1e-40130190262
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     ++k l+cprCds +tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+s+
  MA_175298g0010 130 PDKLLPCPRCDSLDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKHST 190
                     78999*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027013.0E-32132188IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.929134188IPR003851Zinc finger, Dof-type
PROSITE patternPS013610136172IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-23138187IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 545 aa     Download sequence    Send to blast
MKDPGFKLFG KTIPMRDGEK SEGLSGSKLG HENTDNTTET PARVAPVSDK DVGKEMSPEP  60
ELEGPHDSNP EETRSVTVIS DCGEDECKKS VEDLEREGGT TSTENDLKGE NIEEKEAKAS  120
ENQDKMLKKP DKLLPCPRCD SLDTKFCYYN NYNVNQPRHF CKNCQRYWTA GGTMRNVPVG  180
AGRRKNKHST SHYRHMMMAD GLATARADAP DAAAHHQVIS NAHSSSRVLK GSQIQLLPLD  240
VESAGGTILN FGPDFPLCES MSTALNLADQ TVVTRKSFKN KDDEKGPLIC GENRDDTSCE  300
SSITASTTTE KEEASKIFHT IPQMDQGGMV GWPSSVPPQQ HYYGGGPWAY GWNFCWGGRS  360
ATGCPSGIPY AAESGNTSAG SWNNGTSGAG PPGMWAAGIP WPFVPGPYWA SPTGWGGGTW  420
NTPFPTLASP ATGGLSSCPS LSSASSSGSA TLGKHSRDIS QSEGKPDGCL WVPKTIRIDD  480
PDEAARSSIW STLGIGNKPE SITTGGIFKA FQPKTEEKDL VKASTQGLLS NPAAHSRSMA  540
FREST
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00046PBMTransfer from AT5G39660Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC6886840.0KC688684.1 Pinus pinaster Dof10 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLT2B8P60.0T2B8P6_PINPS; Dof10
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.22e-39cycling DOF factor 2