PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_17313g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family NF-YA
Protein Properties Length: 240aa    MW: 26542.8 Da    PI: 10.6221
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_17313g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA104.21.2e-321773158
      CBFB_NFYA  1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
                   +ep+YVNaKQy++Il+RRq Rak+e+ekk+ +k rkpylheSRh hA+rR+Rg+gGrF
  MA_17313g0010 17 EEPVYVNAKQYHGILRRRQLRAKAESEKKV-IKVRKPYLHESRHLHAMRRARGCGGRF 73
                   69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.2E-371576IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.1841676IPR001289Nuclear transcription factor Y subunit A
PfamPF020454.7E-281873IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006166.0E-241941IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS0068602141IPR018362CCAAT-binding factor, conserved site
PRINTSPR006166.0E-245073IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MLGVQQARMP LRIETEEEPV YVNAKQYHGI LRRRQLRAKA ESEKKVIKVR KPYLHESRHL  60
HAMRRARGCG GRFLNTKKLE QSKVNTGNGR GLEGPPGQAG SSSGSEGFQS RDGNLRILQE  120
VQGTTSRMSS SKVSSLEKSY TDEKSYLYSR NNGVYHSGRL QQHFHMSAFH HLSSGSDKGE  180
SGDARGLVSN GSQQRAVEIL STVSNNASGL VEKLTYASDT FQGNSFLAVC VFARGLLIRS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A6e-211777262NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1174710.0BT117471.1 Picea glauca clone GQ03901_C22 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006838331.14e-48nuclear transcription factor Y subunit A-1
TrEMBLA0A023R6U31e-130A0A023R6U3_9SPER; NFYA4
STRINGERN009002e-47(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6801672
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.18e-38nuclear factor Y, subunit A7