PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_171937g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family NF-YA
Protein Properties Length: 389aa    MW: 45624.4 Da    PI: 10.2179
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_171937g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA24.21.1e-072958434
       CBFB_NFYA  4 lYVNaKQyqrIlkRRqkRakleeekkldeks 34
                    ++VNaKQy++IlkRR +  k e+++     +
  MA_171937g0010 29 VWVNAKQYRGILKRRLAHLKWEQTREK-RSQ 58
                    89*****************99994432.222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5115210.4382593IPR001289Nuclear transcription factor Y subunit A
PfamPF020456.4E-62968IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MGQETLEPVE TNDIGQVKIA SSAKTEKWVW VNAKQYRGIL KRRLAHLKWE QTREKRSQRE  60
STWVLRKKQH SNKSSLQVCG NKSKGKGKVI DDYALYSPTS TPLTWSFDLY VKELLKVKER  120
LEVVEAKELK RDCIIHRIIA ENQDLEENNK VLKEQVSLLQ EALRMGKTKW QCMKEEVKNM  180
KKIAVENTEV MNAKPSQDKE KVVTQIDNNE ETSREDRKGD SAKLSKTWTQ IISNPSKREG  240
ERNIQVDNMQ DRERKEKHDR ATNIIIKGVK DYWKNECTLD LARDFLKDKL QWQGQICQAW  300
RVGKPNGERA RPIKVIFPNL CDKEIILSKK HFLRGSQFFL EEDLTVRQQE ERRDEMTKVR  360
ATRDEGKIAW IYKGKAMIVQ FGPPSKTRQ