PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_170661g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family LBD
Protein Properties Length: 180aa    MW: 19949.7 Da    PI: 6.2446
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_170661g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.12.7e-42151141100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+C ++Cvlapyfp+++ +kfa +h++FGasn++kll++lp e r+da+ss+vyeA+ar+rdPvyG++g+++++q+ql+ql+++l 
  MA_170661g0010  15 PCAACKILRRRCREKCVLAPYFPSNDFHKFATAHRIFGASNIIKLLQKLPAEGRTDAVSSMVYEANARLRDPVYGCAGIVFQMQSQLCQLQSQLT 109
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  MA_170661g0010 110 TAQAE 114
                     99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.76514115IPR004883Lateral organ boundaries, LOB
PfamPF031953.6E-4115112IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MASNVGGFRA HAPSPCAACK ILRRRCREKC VLAPYFPSND FHKFATAHRI FGASNIIKLL  60
QKLPAEGRTD AVSSMVYEAN ARLRDPVYGC AGIVFQMQSQ LCQLQSQLTT AQAEILTMRL  120
QQNNLLALIT GSEDSGETTR PLSLSSSAIS QENNEQQTDL IYLEGEDPLQ LWDDSVWTQL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-381411610112LOB family transfactor Ramosa2.1
5ly0_B5e-381411610112LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF0845570.0EF084557.1 Picea sitchensis clone WS0271_N08 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009409552.11e-60PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR07e-56LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA9NTB01e-111A9NTB0_PICSI; Uncharacterized protein
STRINGGSMUA_Achr7P15500_0014e-60(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.18e-50LOB domain-containing protein 1