PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_170369g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family LBD
Protein Properties Length: 193aa    MW: 21318.2 Da    PI: 6.5042
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_170369g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260122.62.1e-38281271100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+C ++ vlapyfp+++ +kfa +h++FGasn++kll++l  e r da+s +vyeA+ar+rdPvyG++g+++++q+ql+ql+++la
  MA_170369g0010  28 PCAACKILRRRCREKFVLAPYFPSNDLHKFATAHRIFGASNIIKLLQELLAEGRADAVSNMVYEANARLRDPVYGCAGIVFQMQSQLSQLQSQLA 122
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  MA_170369g0010 123 TAQAE 127
                     *9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.97127128IPR004883Lateral organ boundaries, LOB
PfamPF031953.9E-3728125IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MAPSHQTFSE LPQMASNVGG FRAHAPSPCA ACKILRRRCR EKFVLAPYFP SNDLHKFATA  60
HRIFGASNII KLLQELLAEG RADAVSNMVY EANARLRDPV YGCAGIVFQM QSQLSQLQSQ  120
LATAQAEILT MRLQQANFLA LITGSADSGK TTRPLSPSSN AISQESNDQQ TDLIYFEGED  180
PLQLWDDSVW TQL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-352712910112LOB family transfactor Ramosa2.1
5ly0_B2e-352712910112LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF0845570.0EF084557.1 Picea sitchensis clone WS0271_N08 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009409552.12e-59PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR04e-53LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA9NTB01e-112A9NTB0_PICSI; Uncharacterized protein
STRINGGSMUA_Achr7P15500_0016e-59(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.11e-45LOB domain-containing protein 1