PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_16891g0020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family LBD
Protein Properties Length: 245aa    MW: 26671.3 Da    PI: 8.4905
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_16891g0020genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601253.7e-3941138199
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaCk+ r+ C+++Cv+apyfp +qp+kfa vhk+FGasn+ kll++lp+++reda+ssl+yeAear++dPvy +vg i+ lq q++ql+ ++++
  MA_16891g0020  41 PCAACKFPRK-CTAECVFAPYFPPKQPHKFASVHKIFGASNIDKLLNELPPHQREDAASSLAYEAEARVKDPVYDCVGAISPLQGQVQQLQRDIEE 135
                    7******998.**********************************************************************************999 PP

         DUF260  97 lke 99 
                    +++
  MA_16891g0020 136 ARA 138
                    886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.56540140IPR004883Lateral organ boundaries, LOB
PfamPF031958.9E-3841137IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MMNMVLGSTG TFFKGNNISS KQTTSSSSSA SGSCSSSSSS PCAACKFPRK CTAECVFAPY  60
FPPKQPHKFA SVHKIFGASN IDKLLNELPP HQREDAASSL AYEAEARVKD PVYDCVGAIS  120
PLQGQVQQLQ RDIEEARADL ARYIAMEMGM QGIHGVPVHH SSHRLLELRR ERVLELARLQ  180
RSGGPCSEAL GLAAAAGIYN ITTSSPCLPT HPTSPYSLSL PTHPPPTCTP THTRWREFIR  240
WGVYI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-51351495120LOB family transfactor Ramosa2.1
5ly0_B1e-51351495120LOB family transfactor Ramosa2.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024361359.13e-56protein LATERAL ORGAN BOUNDARIES-like
TrEMBLA0A2K1INT76e-55A0A2K1INT7_PHYPA; Uncharacterized protein
STRINGPP1S71_7V6.11e-55(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.14e-52LOB domain-containing protein 25