PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_16891g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family LBD
Protein Properties Length: 235aa    MW: 24253.9 Da    PI: 7.1523
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_16891g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.31.1e-4222120199
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaCk+lrrkC+ +C++apyfp eqp+kfa vhk+FGa  ++kll++l++e+reda+ssl+yeAear++dPvyG+vg i+ lq q++ql+ ela+
  MA_16891g0010  22 PCAACKFLRRKCTVECIFAPYFPPEQPHKFASVHKIFGAXXISKLLNELSPEQREDAVSSLAYEAEARVKDPVYGCVGAISVLQGQVQQLQRELAE 117
                    7**********************************************************************************************9 PP

         DUF260  97 lke 99 
                    +++
  MA_16891g0010 118 ARA 120
                    987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.01221122IPR004883Lateral organ boundaries, LOB
PfamPF031951.0E-4122119IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MAASSSTSSS ASASGSSTAS SPCAACKFLR RKCTVECIFA PYFPPEQPHK FASVHKIFGA  60
XXISKLLNEL SPEQREDAVS SLAYEAEARV KDPVYGCVGA ISVLQGQVQQ LQRELAEARA  120
DLAHYTAMEM GIQGIHGVPV HHSSQGLLEL RRERILELAR LQGSGGPCSE ALGAAAAAGI  180
YNIASCPPPP LLPPTHPPPA CTTCTTIASE GGSGCSSGGG GVGNSGSIRH YSSPP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-54191318120LOB family transfactor Ramosa2.1
5ly0_B1e-54191318120LOB family transfactor Ramosa2.1
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1193590.0BT119359.1 Picea glauca clone GQ04104_K10 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024403438.14e-59LOB domain-containing protein 6-like
TrEMBLA0A2K1IZ189e-58A0A2K1IZ18_PHYPA; Uncharacterized protein
STRINGPP1S170_78V6.12e-58(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.41e-57LBD family protein