PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_16692g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family Dof
Protein Properties Length: 395aa    MW: 44407.6 Da    PI: 7.5472
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_16692g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.33.8e-3951111262
         zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                    +ekalkcprC+stntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGg++rknk+++
  MA_16692g0010  51 PEKALKCPRCESTNTKFCYYNNYSLSQPRYFCKTCRRYWTKGGTLRNVPVGGSCRKNKRVK 111
                    6899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-2749109IPR003851Zinc finger, Dof-type
PfamPF027011.2E-3353109IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.15255109IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105793IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MTKFMGASSI QVCMDYIQCP QVTQERVPMD HKDMMGFSPS LLERGGLKPP PEKALKCPRC  60
ESTNTKFCYY NNYSLSQPRY FCKTCRRYWT KGGTLRNVPV GGSCRKNKRV KRSPPDQPLA  120
RQTELTSTST HGEDHNNNND FRSCCSLDND NIASLSNSMY YGGNNNNNDI IHKAFPRIQE  180
AVGDGFTFTN CNNSDFLGST CGGRPSLSNY LSPMSSLASV WAANSTQLRP ISSSTFSGPG  240
FDKSLKLVDH EALCPADPNS TMESHQQISE PVGVQNFAPF TMDCGLNRVH PDRVQWRLHE  300
QQQQKFEPPM QASEGHVMLR LKDQTVEHPC RQSKALEDFM SSFGCNKGGL EEKEWQNPSD  360
QANYETAKDS IYWNGRSWPY LPNYASSSCQ KDGEI
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.19e-36TARGET OF MONOPTEROS 6