PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_161258g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family GATA
Protein Properties Length: 463aa    MW: 49655.4 Da    PI: 10.3034
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_161258g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.81.5e-18258292135
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                     C+ C+t kTplWR+gp+g+k+LCnaCG++y+k g+
  MA_161258g0010 258 CTDCKTVKTPLWRNGPQGPKSLCNACGIRYKKLGK 292
                     ********************************886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004013.1E-19252309IPR000679Zinc finger, GATA-type
SuperFamilySSF577165.23E-14252294No hitNo description
PROSITE profilePS5011413.007252288IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.103.8E-17256295IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.13E-13257295No hitNo description
PROSITE patternPS003440258283IPR000679Zinc finger, GATA-type
PfamPF003201.9E-16258292IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 463 aa     Download sequence    Send to blast
RRSTLAVGCG GWTAVVDPGG RTITAQVTRR TAQIFLGSLF AISPAVVGSR RLRSGGGAVN  60
AEAKTGGFGF ASVGAVGLLE WRKIAESCRG AAAAAYYSTP VYGHSHYKKF WLKKMESEDD  120
PPAAAPPESG VLLRNKPAYA VNCSPLELRG SCSPPSSSSV RMCGVKTVTE NNNIKKKARC  180
PPEKSSHHKC ELDYTLAIGV GVGMSGASSE ENKDVSDGFY DDKFHKFMVP ASNSTGHEDA  240
QPFNPINNNS PRAVTRVCTD CKTVKTPLWR NGPQGPKSLC NACGIRYKKL GKRPIGNLER  300
PSSPPTPPIS PSAKQIIKLS KRKREGEAGK TKQQLEDAAA TTAAAVSQHH PRKRIKTTSV  360
MEKLAGGRSD RVAMGPGSLS LSSPSRSQSE APDSPRLEQS EGGYYAEERN RNGSGRGEAL  420
RRWREVERIK RGLLRYGKIR SLAKDEEEGA VLLMALSCGV ASC
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ0799311e-119FJ079931.1 Pinus taeda isolate 4712 anonymous locus 0_738_01 genomic sequence.
GenBankFJ0799301e-119FJ079930.1 Pinus taeda isolate 4720 anonymous locus 0_738_01 genomic sequence.
GenBankFJ0799291e-119FJ079929.1 Pinus taeda isolate 4718 anonymous locus 0_738_01 genomic sequence.
GenBankFJ0799281e-119FJ079928.1 Pinus taeda isolate 4722 anonymous locus 0_738_01 genomic sequence.
GenBankFJ0799271e-119FJ079927.1 Pinus taeda isolate 4726 anonymous locus 0_738_01 genomic sequence.
GenBankFJ0799261e-119FJ079926.1 Pinus taeda isolate 4716 anonymous locus 0_738_01 genomic sequence.
GenBankFJ0799251e-119FJ079925.1 Pinus taeda isolate 4727 anonymous locus 0_738_01 genomic sequence.
GenBankFJ0799241e-119FJ079924.1 Pinus taeda isolate 4713 anonymous locus 0_738_01 genomic sequence.
GenBankFJ0799231e-119FJ079923.1 Pinus taeda isolate 4724 anonymous locus 0_738_01 genomic sequence.
GenBankFJ0799221e-119FJ079922.1 Pinus taeda isolate 4715 anonymous locus 0_738_01 genomic sequence.
GenBankFJ0799211e-119FJ079921.1 Pinus taeda isolate 4725 anonymous locus 0_738_01 genomic sequence.
GenBankFJ0799201e-119FJ079920.1 Pinus taeda isolate 4723 anonymous locus 0_738_01 genomic sequence.
GenBankFJ0799191e-119FJ079919.1 Pinus taeda isolate 4717 anonymous locus 0_738_01 genomic sequence.
GenBankFJ0799181e-119FJ079918.1 Pinus taeda isolate 4728 anonymous locus 0_738_01 genomic sequence.
GenBankFJ0799171e-119FJ079917.1 Pinus taeda isolate 4714 anonymous locus 0_738_01 genomic sequence.
GenBankFJ0799161e-119FJ079916.1 Pinus taeda isolate 4721 anonymous locus 0_738_01 genomic sequence.
GenBankFJ0799151e-119FJ079915.1 Pinus taeda isolate 4719 anonymous locus 0_738_01 genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0C9QUV91e-102A0A0C9QUV9_9SPER; TSA: Wollemia nobilis Ref_Wollemi_Transcript_7873_1747 transcribed RNA sequence
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56860.17e-15GATA family protein