PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_14087g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family G2-like
Protein Properties Length: 515aa    MW: 57398.6 Da    PI: 6.8811
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_14087g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.21.6e-32260315156
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                    k r++W+peLH+rFv+a++qLGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  MA_14087g0010 260 KSRRCWSPELHRRFVNALQQLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 315
                    68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-29257318IPR009057Homeodomain-like
PROSITE profilePS5129414.264257317IPR017930Myb domain
SuperFamilySSF466896.72E-18257318IPR009057Homeodomain-like
TIGRFAMsTIGR015574.5E-27260315IPR006447Myb domain, plants
PfamPF002492.0E-7262313IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 515 aa     Download sequence    Send to blast
MRRHEEYIKG LEEERKKIEV FKRELPFCMQ LLNDAIEACK EQLADCERAS LHEDVQNAPN  60
TNGRPVLEEF IPIKKSYQAT ENKLEENHVA KKARFNNGDK PNWMISANLW NPDPETIDSR  120
KGGGISMEES LKEQDSQYQV HSFPSNHKLF SDSKHRMGGA FHPFSKERQV IAPRPVRSTV  180
ERTLPNLALS SAEREVDSSL VGNETVCLDA TTTTTARISR SKETTEVHTP VHEKEAVING  240
ANTSPTTSTP NTSQTQTQRK SRRCWSPELH RRFVNALQQL GGSQVATPKQ IRELMKVDGL  300
TNDEVKSHLQ KYRLHTRRPS PSPPSSNPQA PHLVVLGGIW VPPEYAAHAA AAAQQGQGGL  360
YNPLPTTVPC PPQSHYCQPS LPQGHEYYCQ MNPAASKLQL HHSVSHYCDQ QQEQQQQTPS  420
QSQNSPQGPL QCNGHSSGAR GTSADAGREE SVGEDAKSDS SSWKDEDSGE TTEVMNMGRG  480
LSLRKQPHEF LDEDDGDATD NRARVQMGKQ TLVGR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-13260313255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-13260313255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A9e-14260313154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B9e-14260313154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C9e-14260313154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D9e-14260313154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-13260313255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-13260313255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-13260313255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-13260313255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-13260313255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-13260313255Protein PHOSPHATE STARVATION RESPONSE 1
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1150730.0BT115073.1 Picea glauca clone GQ03608_I11 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A171NYB91e-174A0A171NYB9_TAXWC; GARP2
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP43031624
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-68G2-like family protein