PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_13587g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family HD-ZIP
Protein Properties Length: 314aa    MW: 35075.9 Da    PI: 6.3776
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_13587g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.78.5e-18197251256
                    T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  MA_13587g0010 197 RKKLRLSKEQSAYLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 251
                    778899***********************************************98 PP

2HD-ZIP_I/II128.13.8e-41197286191
    HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                    +kk+rlskeq++ LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr+y++l+een+rL+k+ +eLr +l
  MA_13587g0010 197 RKKLRLSKEQSAYLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCYETLTEENRRLQKDIQELR-AL 286
                    69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046181.4E-1043150IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.602.1E-17183251IPR009057Homeodomain-like
PROSITE profilePS5007117.086193253IPR001356Homeobox domain
SuperFamilySSF466891.45E-18195262IPR009057Homeodomain-like
SMARTSM003894.9E-16195257IPR001356Homeobox domain
CDDcd000861.90E-15197254No hitNo description
PfamPF000463.3E-15197251IPR001356Homeobox domain
PROSITE patternPS000270228251IPR017970Homeobox, conserved site
SMARTSM003403.4E-24253296IPR003106Leucine zipper, homeobox-associated
PfamPF021831.5E-10253287IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MDLGLGLGGE DIVVRPAESW IQFQKMTSAT KADLVQNTEL FLRLGLELGS QRQNTANPNP  60
PIQLDLLPAA PVPRGFSWHP NTKTYRAASE NGNCEGDYGE TRSCGQGGGA ASASSPRGFD  120
VNRVPSSADN DNEDDDDAAV SSPNSTISSF QMDFAICHAT SAVKRERDGE RDNNANDNEL  180
DRDCSRGSDE EEGGGTRKKL RLSKEQSAYL EESFKEHNTL NPKQKLALAK QLNLRPRQVE  240
VWFQNRRART KLKQTEVDCE YLKRCYETLT EENRRLQKDI QELRALKVAH PSFYMHLPAT  300
TLTIFSVRAL KRNG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1195201TRKKLRL
2245253RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF0852290.0EF085229.1 Picea sitchensis clone WS0271_I13 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006849539.11e-101homeobox-leucine zipper protein HOX11
SwissprotQ67UE25e-77HOX11_ORYSJ; Homeobox-leucine zipper protein HOX11
TrEMBLA9NV750.0A9NV75_PICSI; Uncharacterized protein
STRINGERN111201e-100(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-58homeobox from Arabidopsis thaliana