PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_131805g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family LBD
Protein Properties Length: 163aa    MW: 18137.6 Da    PI: 6.5012
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_131805g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260911.5e-2835129498
          DUF260   4 aCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                     +C + +++C ++C++   f++++ +kfa++h++FGa nv+kl+++l++++r da++s+vyeA ar++dP  G++g+i +lq+q++ l++++ +++
  MA_131805g0010  35 VCDMEKKECLNNCTILYRFASNDLRKFAILHQVFGACNVIKLIQDLSPDQRVDAVNSMVYEASARLQDPALGCTGIIYELQRQISVLESQITTTR 129
                     7**************************************************************************************99998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089119.03231132IPR004883Lateral organ boundaries, LOB
PfamPF031955.8E-2735128IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
RFHQSTTGSA RLNHMMSNAK EKPLAQSPSV DFHDVCDMEK KECLNNCTIL YRFASNDLRK  60
FAILHQVFGA CNVIKLIQDL SPDQRVDAVN SMVYEASARL QDPALGCTGI IYELQRQISV  120
LESQITTTRG MIQKIRLQEA ELLASIPGFG TASEEDTTGI GHH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-243612515104LOB family transfactor Ramosa2.1
5ly0_B6e-243612515104LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1011540.0BT101154.1 Picea glauca clone GQ0069_F04 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA9P1U32e-58A9P1U3_PICSI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.16e-33LOB domain-containing protein 11