PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_13024g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family LBD
Protein Properties Length: 212aa    MW: 23834.3 Da    PI: 7.0712
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_13024g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260122.13e-38541531100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaCk +++kC+++Cvlapyfp+++p+kf  vh++FG+ +v+kll+ lp e+r +a+ss+vyeA  r+rdPv+G+vgvi++lq+++++l+++l++
  MA_13024g0010  54 PCAACKRQKKKCSEKCVLAPYFPQNDPQKFLSVHRVFGNVHVIKLLQGLPAERRGEAVSSMVYEASERLRDPVHGCVGVINDLQKRVAELQSQLVS 149
                    7*********************************************************************************************99 PP

         DUF260  97 lkee 100
                    +++ 
  MA_13024g0010 150 TQAD 153
                    8875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.67953154IPR004883Lateral organ boundaries, LOB
PfamPF031956.7E-3854151IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MHLTRLPIYL TSLGLGLEFY IPCLWKNCNL DINTEMSATM SDMSANSKTE TSYPCAACKR  60
QKKKCSEKCV LAPYFPQNDP QKFLSVHRVF GNVHVIKLLQ GLPAERRGEA VSSMVYEASE  120
RLRDPVHGCV GVINDLQKRV AELQSQLVST QADLANIRLL HANLLTLTRG YHQVLDPNFY  180
SGSLQAEIKD TNTNPPVLDD ADPLQLWESL WT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-33441541111LOB family transfactor Ramosa2.1
5ly0_B6e-33441541111LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004240601.12e-48LOB domain-containing protein 1-like
TrEMBLB8LQI91e-75B8LQI9_PICSI; Uncharacterized protein
STRINGSolyc06g005090.2.16e-48(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.12e-46LOB domain-containing protein 1