PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_127139g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family LBD
Protein Properties Length: 151aa    MW: 16656.2 Da    PI: 8.4955
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_127139g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260144.92.4e-45141131100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+CakdC++apyfp+++p+kfa vh++FGasnv k+l++lpee+r da+ss+vyeA+ar+rdP+yG+vg i++lqqq++ lk++la
  MA_127139g0010  14 PCAACKLLRRRCAKDCIFAPYFPSDDPHKFASVHRVFGASNVNKMLQDLPEEQRGDAVSSMVYEANARVRDPIYGCVGAISSLQQQVAILKSQLA 108
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     l+++e
  MA_127139g0010 109 LAQAE 113
                     *9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.34213114IPR004883Lateral organ boundaries, LOB
PfamPF031951.9E-4414111IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 151 aa     Download sequence    Send to blast
MRETISKSSN GMSPCAACKL LRRRCAKDCI FAPYFPSDDP HKFASVHRVF GASNVNKMLQ  60
DLPEEQRGDA VSSMVYEANA RVRDPIYGCV GAISSLQQQV AILKSQLALA QAEIVHLKMR  120
QSQTSLSALF TNTNSKIMMM DEGSSPTHML D
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-461311510112LOB family transfactor Ramosa2.1
5ly0_B5e-461311510112LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1074400.0BT107440.1 Picea glauca clone GQ03107_I11 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004294159.11e-72PREDICTED: LOB domain-containing protein 4
SwissprotQ9SHE95e-61LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A2P6Q8S71e-70A0A2P6Q8S7_ROSCH; Putative transcription factor AS2-LOB family
STRINGXP_004294159.14e-72(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.12e-63LOB domain-containing protein 4