PlantRegMap
Plant Transcription Factor Database
PlantTFDB
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_126021g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family HD-ZIP
Protein Properties Length: 278aa    MW: 31295.8 Da    PI: 9.4672
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_126021g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.93.4e-18126180256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ +++k+q   Lee F++++ +s +++  LA kl+L+ rqV vWFqNrRa+ k
  MA_126021g0010 126 RKKLRLSKDQSSLLEESFREHSALSPKHKSALACKLNLQPRQVEVWFQNRRARTK 180
                     788899***********************************************98 PP

2HD-ZIP_I/II115.33.6e-37126214189
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                     +kk+rlsk+q++lLEesF+e++ L+p++K++la +L+lqprqv+vWFqnrRARtk+k+ E++++ Lkr++++l+een+rL +ev++Lr+
  MA_126021g0010 126 RKKLRLSKDQSSLLEESFREHSALSPKHKSALACKLNLQPRQVEVWFQNRRARTKLKRKEVECDNLKRCCESLREENRRLVREVQALRA 214
                     69*************************************************************************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.13E-17122189IPR009057Homeodomain-like
PROSITE profilePS5007116.293122182IPR001356Homeobox domain
SMARTSM003893.4E-15124186IPR001356Homeobox domain
CDDcd000861.60E-13125180No hitNo description
PfamPF000461.8E-15126180IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.5E-17126180IPR009057Homeodomain-like
PROSITE patternPS000270157180IPR017970Homeobox, conserved site
SMARTSM003406.3E-12182225IPR003106Leucine zipper, homeobox-associated
PfamPF021831.6E-7185216IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
TPVAPGHKSG EGVSRLCNSS HRPKKEKRME EDNTELSLKL RYEDETVSFI NPDTEARRFC  60
RRTLAGSAEH SAQDMVSTQG EFNASSGSLI SARCAFVKRE ILDMDAVSCR APRDELDDMI  120
IPGTPRKKLR LSKDQSSLLE ESFREHSALS PKHKSALACK LNLQPRQVEV WFQNRRARTK  180
LKRKEVECDN LKRCCESLRE ENRRLVREVQ ALRAMKIVRG TGKEDLYAQS PLAAATLTMC  240
PSCERLATKT STTTIASQTK TIPPRLISQF PCNQSAVC
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1077920.0BT107792.1 Picea glauca clone GQ03112_M24 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006399145.15e-51homeobox-leucine zipper protein HAT14
RefseqXP_021622568.18e-51homeobox-leucine zipper protein HOX11-like
SwissprotP466653e-49HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A1Q3CBL04e-50A0A1Q3CBL0_CEPFO; Homeobox domain-containing protein/HALZ domain-containing protein
STRINGLus100210641e-50(Linum usitatissimum)
STRINGXP_006399145.12e-50(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.17e-41homeobox from Arabidopsis thaliana