PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_123810g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family Dof
Protein Properties Length: 348aa    MW: 37748.8 Da    PI: 6.0893
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_123810g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.52.9e-3863122261
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                     +++ lkcprCds ntkfCyynny+lsqPr+fCkaCrryWtkGG lr vPvGgg+rknkk+
  MA_123810g0010  63 PSQVLKCPRCDSLNTKFCYYNNYNLSQPRHFCKACRRYWTKGGVLRSVPVGGGCRKNKKT 122
                     56889*****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2661121IPR003851Zinc finger, Dof-type
PfamPF027013.9E-3365121IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.31167121IPR003851Zinc finger, Dof-type
PROSITE patternPS01361069105IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MDSELVLDAM RNLPNNRFAA SSIEMLAAMP DQISVEPPPD SSALFAAPRG GRLTGERRAR  60
PHPSQVLKCP RCDSLNTKFC YYNNYNLSQP RHFCKACRRY WTKGGVLRSV PVGGGCRKNK  120
KTRPRNPDPM KSSSFSPADA SSSENSTVTG TPSSSSSNSR VNTPAGDGTA GLYGFGLELQ  180
EALTERANCS VPAEECSTIP VPAPFNGLTT LDYGTVDAMD QQIHVNPELL NSGDLLDASS  240
CSFGDLIGSS NLAGVTLADL QWKLQQQHKL ASLFGEGSNS NNFDTVAAQN GNNYSSHIHN  300
SYSNAIPLHW QTNNNNMDAL FEDLYNWGTE TELNWPDQAP ILHTSKIG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1223610.0BT122361.1 Picea sitchensis clone WS0444_E05 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLD5A8780.0D5A878_PICSI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.18e-35OBF binding protein 4