PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_11699g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family LBD
Protein Properties Length: 99aa    MW: 11148.5 Da    PI: 3.8541
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_11699g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26037.76e-1214061100
         DUF260  61 lvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                    +vyeA  r+rdPv+G+vg+i++lq+++++l+++la++++e
  MA_11699g0010   1 MVYEASERIRDPVHGCVGIINELQNKVAELQSQLASAQAE 40 
                    69*********************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031951.1E-9138IPR004883Lateral organ boundaries, LOB
PROSITE profilePS508919.551141IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 99 aa     Download sequence    Send to blast
MVYEASERIR DPVHGCVGII NELQNKVAEL QSQLASAQAE ITNITLQHVN LLPLVTGYHE  60
LSDPNFFCLS PQESEEMTQT SPSVLDDLDP LELWEPLWT
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1093751e-145BT109375.1 Picea glauca clone GQ03207_L09 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018845317.13e-22PREDICTED: LOB domain-containing protein 1-like
TrEMBLB8LQI91e-31B8LQI9_PICSI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1626323
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.19e-11LOB domain-containing protein 1