PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_113501g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family LBD
Protein Properties Length: 191aa    MW: 21242.9 Da    PI: 6.8381
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_113501g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.28.2e-45111101100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +Ca+Ck+lrr+CakdCv+apyfpa+qp+kfa vhk+FGasnv+k+l++lp ++r da+ss+vyeA+ar+rdPvyG+vg i+ lqqq+++l+ +la
  MA_113501g0010  11 PCASCKLLRRRCAKDCVFAPYFPADQPQKFASVHKVFGASNVSKMLQELPVHQRADAVSSMVYEANARVRDPVYGCVGAISYLQQQVANLQMQLA 105
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     + ++e
  MA_113501g0010 106 RSQAE 110
                     99887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.41710111IPR004883Lateral organ boundaries, LOB
PfamPF031952.7E-4411108IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MGTSKASGSS PCASCKLLRR RCAKDCVFAP YFPADQPQKF ASVHKVFGAS NVSKMLQELP  60
VHQRADAVSS MVYEANARVR DPVYGCVGAI SYLQQQVANL QMQLARSQAE IMCMHIQQQE  120
ALLSDSTDNI DSKQAIMGTM NDHQLHYDQI HANNYHHPSD CSTSSHDSPQ QLLTHAQTVY  180
DSLDIREALW T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-4931124112LOB family transfactor Ramosa2.1
5ly0_B3e-4931124112LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1027030.0BT102703.1 Picea glauca clone GQ02011_K24 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010685903.23e-70PREDICTED: LOB domain-containing protein 12
RefseqXP_011624484.12e-70LOB domain-containing protein 12-like
SwissprotQ8LBW33e-66LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A2R6QJD94e-68A0A2R6QJD9_ACTCH; LOB domain-containing protein
STRINGGLYMA11G29450.19e-69(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.11e-68LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]