PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_11285g0020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family LBD
Protein Properties Length: 193aa    MW: 21795.8 Da    PI: 6.8618
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_11285g0020genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601301e-40351341100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +Ca+Ck++r+kC+++Cvlapyfp+++p+kf  vh++FG+ +v+kll++lp e+r da+s++vyeA  r+rdPv+G+vg+i++lq+++++l+++la+
  MA_11285g0020  35 PCAGCKIQRKKCSEKCVLAPYFPQNNPEKFLLVHRIFGNGHVIKLLQDLPAEQRGDAVSTMVYEASERIRDPVHGCVGIINELQNKVAELQSQLAS 130
                    7**********************************************************************************************9 PP

         DUF260  97 lkee 100
                    +++e
  MA_11285g0020 131 AQAE 134
                    9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.36934135IPR004883Lateral organ boundaries, LOB
PfamPF031959.8E-4035132IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MVKRFRISKK TVTKHSNGKM SEATAFKSQT WSTSPCAGCK IQRKKCSEKC VLAPYFPQNN  60
PEKFLLVHRI FGNGHVIKLL QDLPAEQRGD AVSTMVYEAS ERIRDPVHGC VGIINELQNK  120
VAELQSQLAS AQAEITNITR QHVNLLPLVT EYHEVSDPNF FCLSPQESED MTHTSSSVLD  180
DLDPLELWEP LWT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-35251471123LOB family transfactor Ramosa2.1
5ly0_B4e-35251471123LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1093750.0BT109375.1 Picea glauca clone GQ03207_L09 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007205910.22e-54LOB domain-containing protein 1
SwissprotQ9LQR02e-51LBD1_ARATH; LOB domain-containing protein 1
TrEMBLB8LQI96e-83B8LQI9_PICSI; Uncharacterized protein
STRINGXP_008224697.11e-53(Prunus mume)
STRINGEMJ071098e-54(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.11e-42LOB domain-containing protein 1