PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_112632g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family NF-YA
Protein Properties Length: 194aa    MW: 21265 Da    PI: 7.8201
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_112632g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.91.4e-3296152158
       CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                     +ep+YVNaKQy +Il+RRq+Rak+e+e+kl +k+rkpylheSRh hAl+R+Rg+gGrF
  MA_112632g0010  96 EEPVYVNAKQYYGILRRRQSRAKAESENKL-IKNRKPYLHESRHLHALKRARGCGGRF 152
                     69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.5E-3794155IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.29295155IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.0E-2797152IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006164.3E-2398120IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860100120IPR018362CCAAT-binding factor, conserved site
PRINTSPR006164.3E-23129152IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
IDGSAPDEQQ PQADPVQQEA PPPGMIPPPA MTLLPPEFVM PHTQLELGQA MVRAAYPYPD  60
PYFGGIVAAY GPQAVIHPHM LGVPHAGLPL PSDAVEEPVY VNAKQYYGIL RRRQSRAKAE  120
SENKLIKNRK PYLHESRHLH ALKRARGCGG RFLNAKKQDE VSQENNSNGN IVHVPSVDKP  180
DAEKKSSSAQ NTDS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A7e-2295159165NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1044180.0BT104418.1 Picea glauca clone GQ02810_C14 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020268973.15e-71nuclear transcription factor Y subunit A-7 isoform X1
RefseqXP_020268974.15e-71nuclear transcription factor Y subunit A-7 isoform X1
RefseqXP_020268975.15e-71nuclear transcription factor Y subunit A-7 isoform X1
RefseqXP_020268976.15e-71nuclear transcription factor Y subunit A-7 isoform X1
SwissprotQ84JP15e-49NFYA7_ARATH; Nuclear transcription factor Y subunit A-7
TrEMBLA0A2K1KAU83e-66A0A2K1KAU8_PHYPA; Uncharacterized protein
STRINGPP1S42_174V6.15e-67(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6801672
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.21e-51nuclear factor Y, subunit A7
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]