PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_1076042g0020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family NF-YA
Protein Properties Length: 229aa    MW: 26761.7 Da    PI: 10.3344
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_1076042g0020genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA27.69.6e-093162436
        CBFB_NFYA  4 lYVNaKQyqrIlkRRqkRakleeekkldeksrk 36
                     +++NaKQy +IlkRR +R k e+++k    +r 
  MA_1076042g0020 31 VWINAKQYWGILKRRLARLKWEQTRKK-RSQRE 62
                     78*********************8885.33333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF020453.6E-73170IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MTMGQETLEP VETNDTGQVK IASSTKNGKW VWINAKQYWG ILKRRLARLK WEQTRKKRSQ  60
RESTWVLRKK QHSNKSSLQV CCNKSKEKEK FIDDYALYSP TSTPLTWSSD LYVKELLKVK  120
ERLQVVEAKE LVRDYTIYRI IAENQDFAES NKVLKEQVSL LQEALRMGKT EWQRMKAEVQ  180
NMKKIAVENT KVMNAKPSQD KGKVVTQIEN NEETSREERK GDSAKLSKT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14257KRRLARLKWEQTRKKR