PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_10436933g0030
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family Dof
Protein Properties Length: 401aa    MW: 44180.9 Da    PI: 7.6972
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_10436933g0030genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1183.6e-37221281262
            zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                       ++k l cprCds+ tkfCyynny+++qPr+fCkaC+ryWt GG++rnvPvG+g+rknk+s 
  MA_10436933g0030 221 TDKLLCCPRCDSSGTKFCYYNNYNVNQPRHFCKACERYWTVGGTMRNVPVGAGQRKNKHSG 281
                       578899****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5093413.874133IPR007526SWIRM domain
Gene3DG3DSA:1.10.10.104.4E-7334IPR011991Winged helix-turn-helix DNA-binding domain
SuperFamilySSF466891.08E-5329IPR009057Homeodomain-like
PfamPF027012.9E-30223279IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.745225279IPR003851Zinc finger, Dof-type
PROSITE patternPS013610227263IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-22227278IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MLVGDVNSIR RVFDFLDNWG LINYQVASSK QHTKAEGNAG GVGEKGVATR VLGQKGLAAS  60
EGNPPPSGTA TNSTVIDGKD KKGTEWQSGL LCNNCGADCS IARFDCLKNS TVIEGKDKKG  120
TEWQSGLLCN NCGADCSIAR FDCLKEVISP KSRDEGLSKE PGNSFGTNNC DVEDVKTSKQ  180
NPEKELPLTA TEEEPKDEKG DETNKEEVEQ NGNKDKLLRK TDKLLCCPRC DSSGTKFCYY  240
NNYNVNQPRH FCKACERYWT VGGTMRNVPV GAGQRKNKHS GTHYWHTMKS VGLTPARTGS  300
SDVAHYSGFV LCPKCHENRN YGLGLSASDF KRVELKEVSQ QKSVEWTDKE TLVLLEAIFF  360
IMTTGNVLHN TLVPKVMMIV FRDSYSFLLE SNILATPAMK I
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF6762960.0EF676296.1 Picea sitchensis clone WS02730_F14 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA9NWA41e-175A9NWA4_PICSI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.15e-33cycling DOF factor 3