PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_10435735g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family Dof
Protein Properties Length: 466aa    MW: 51860.6 Da    PI: 5.7398
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_10435735g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.46.3e-382685261
            zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                      ++k l+cprCds+ tkfCyynny+++qPr+fCk C+ryWt GG++rnvPvG+grrknk+ 
  MA_10435735g0010 26 TDKLLRCPRCDSSGTKFCYYNNYNVNQPRHFCKDCQRYWTVGGTMRNVPVGAGRRKNKHL 85
                      67889****************************************************985 PP

2Myb_DNA-binding32.52e-10150191346
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        WT eE + l++a+ ++  + Wk +a+++g ++++ +c+sr+ +
  MA_10435735g0010 150 EWTDEETLVLLEAIFLHNDD-WKCVAQHVG-TKSEADCVSRFIQ 191
                       7****************988.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027014.3E-312884IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.0533084IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-253283IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103268IPR003851Zinc finger, Dof-type
PROSITE profilePS5129317.176146197IPR017884SANT domain
SMARTSM007175.1E-8147195IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-6147189IPR009057Homeodomain-like
SuperFamilySSF466891.2E-11147204IPR009057Homeodomain-like
CDDcd001672.45E-7150192No hitNo description
PfamPF002498.6E-10150192IPR001005SANT/Myb domain
PfamPF164959.6E-21375452IPR032451SMARCC, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 466 aa     Download sequence    Send to blast
KDEKGDETNK EEVEQNGHKD KLLRKTDKLL RCPRCDSSGT KFCYYNNYNV NQPRHFCKDC  60
QRYWTVGGTM RNVPVGAGRR KNKHLGTHYW HTMKSVGLTP ARTGASDAAH YSGFVLCPKC  120
YENGNYGLGL SASDFKRIEL KEVSQQKSVE WTDEETLVLL EAIFLHNDDW KCVAQHVGTK  180
SEADCVSRFI QLPFGEQYIG NISNEVSDRR SSNVTDENTV IKQVSSPKDR STQDLQDHVS  240
NDDKHTMDDV LGPPLKRRHL TPLADASNPI MGQVAFLSAM VGSHVAEAAA HAAIAALSEE  300
DPSASQVTST QEAECPNQKN GTGASGLEGS PKDFAIEDSK KESHRGTDQT TEDGDSLAGE  360
KEMTTPTVEM RAATATALGS AAVRAKLLAD QEDQDIENLF STVVDSQMKK LQERIQHFEE  420
FDIVTEKERS QVEHIKELLF ADRIRFIQNT IKSRFSGSKE KELEAA
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1104420.0BT110442.1 Picea glauca clone GQ03221_O13 mRNA sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.18e-33cycling DOF factor 3