PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_10435070g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family NF-YA
Protein Properties Length: 286aa    MW: 31888.6 Da    PI: 9.935
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_10435070g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA104.31.1e-32107162258
         CBFB_NFYA   2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                        p+YVNaKQy++Il+RRq+Rak+e+e+kl +ksrkpylheSRh hAlrR+Rg+gGrF
  MA_10435070g0010 107 PPVYVNAKQYHGILRRRQSRAKAESENKL-IKSRKPYLHESRHLHALRRARGCGGRF 162
                       59***************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.7E-37104165IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.558105165IPR001289Nuclear transcription factor Y subunit A
PfamPF020459.4E-28108162IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006169.0E-24108130IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860110130IPR018362CCAAT-binding factor, conserved site
PRINTSPR006169.0E-24139162IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MQNVTTKLGT ESSPSDEQQK QPPQQQQVLP TGISPAHAEF MTRQTQLELG HSGGDTLWQA  60
RTAYPYPDPF YGNYVAAYGA QAMIPPHMLG VHQAGLPLPP SDAVEEPPVY VNAKQYHGIL  120
RRRQSRAKAE SENKLIKSRK PYLHESRHLH ALRRARGCGG RFLNTKKDGN NQEVVSGDQD  180
SHDSIGQDNK VVNSDSGKDG ALQVSNRIQR TDDVAYIGNG ISTHSGTVAP GQVGVEARIP  240
FIRISFSFIW QSRKRPSWRH GFQWRSPYSS SNPMKSEFSY LVMQLP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-19106166262NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1245830.0BT124583.1 Picea sitchensis clone WS0475_F24 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024388758.11e-65nuclear transcription factor Y subunit A-7-like isoform X1
TrEMBLD5AE551e-173D5AE55_PICSI; Uncharacterized protein
STRINGPP1S31_299V6.15e-65(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6801672
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.19e-48nuclear factor Y, subunit A7