PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_10434782g0020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family LBD
Protein Properties Length: 230aa    MW: 25680 Da    PI: 6.1486
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_10434782g0020genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260149.21e-46481471100
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv+kll++l++++reda++sl+yeA+ar+rdPvyG+vgvi+ lq+ql+ql+a+
  MA_10434782g0020  48 PCAACKFLRRKCTPECVFAPYFPPDQPQKFANVHKVFGASNVTKLLNELHPHQREDAVNSLAYEADARLRDPVYGCVGVISILQHQLKQLQAD 140
                       7******************************************************************************************** PP

            DUF260  94 lallkee 100
                       l+ +++e
  MA_10434782g0020 141 LSNARSE 147
                       **99886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.80547148IPR004883Lateral organ boundaries, LOB
PfamPF031958.7E-4648145IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009799Biological Processspecification of symmetry
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009954Biological Processproximal/distal pattern formation
GO:0048441Biological Processpetal development
GO:0005654Cellular Componentnucleoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MIDSFSRFKD YERFLSPLDE RFDWTGIEPD IFNYIFSCDI MASSSNSPCA ACKFLRRKCT  60
PECVFAPYFP PDQPQKFANV HKVFGASNVT KLLNELHPHQ REDAVNSLAY EADARLRDPV  120
YGCVGVISIL QHQLKQLQAD LSNARSELSK YINAGITGPL LGGPASNLGI GMGLPGTSRE  180
HIFREQMMEL CSDEHFCSLG PLNPFTQSSR SSSSHDRNSA RGIDPQINLE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A8e-57451588121LOB family transfactor Ramosa2.1
5ly0_B8e-57451588121LOB family transfactor Ramosa2.1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00211DAPTransfer from AT1G65620Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1173210.0BT117321.1 Picea glauca clone GQ03817_C06 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002266137.14e-73PREDICTED: LOB domain-containing protein 6
TrEMBLA0A443NSI21e-73A0A443NSI2_9MAGN; LOB domain-containing protein 6-like protein
STRINGVIT_00s0340g00090.t011e-72(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.48e-64LBD family protein