PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_10434213g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family LBD
Protein Properties Length: 129aa    MW: 14244 Da    PI: 4.0152
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_10434213g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26066.37.3e-218822599
            DUF260 25 eqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99
                      ++ +kfa++h++FGa nv+kl+++lp ++  +a++s+vyeA ar++dP  G++g+il+lq q++ l++++ ++++
  MA_10434213g0010  8 NDLHKFAILHQVFGACNVIKLIQELPSDQGLEAINSMVYEASARLEDPAFGCTGIILQLQLQISDLESQITSTQT 82
                      6689****************************************************************9998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089113.801184IPR004883Lateral organ boundaries, LOB
PROSITE profilePS512575123No hitNo description
PfamPF031954.5E-20881IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 129 aa     Download sequence    Send to blast
MLYRSTSNDL HKFAILHQVF GACNVIKLIQ ELPSDQGLEA INSMVYEASA RLEDPAFGCT  60
GIILQLQLQI SDLESQITST QTVIQKIRSQ QAQLLASIPG FNDKFNPAIS TVNDADEEDE  120
DLSNSNLMD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-18128239109LOB family transfactor Ramosa2.1
5ly0_B7e-18128239109LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1165250.0BT116525.1 Picea glauca clone GQ03801_F09 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022743269.11e-27LOB domain-containing protein 1-like
SwissprotQ9SK081e-25LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA9P1U38e-56A9P1U3_PICSI; Uncharacterized protein
STRINGPavir.J04684.1.p9e-27(Panicum virgatum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.16e-20LOB domain-containing protein 11