PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_10434193g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family LBD
Protein Properties Length: 180aa    MW: 19839.6 Da    PI: 5.6687
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_10434193g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.71.7e-42151141100
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       +CaaCk+lrr+C ++Cv+apyfp+++ +kf  vh++FGasn++kll++lp e+r+da+ss+vyeA+ar+rdPvyG++g+ +++q+ql+ql+++
  MA_10434193g0010  15 PCAACKMLRRRCGEKCVFAPYFPSNDLHKFVTVHRIFGASNIIKLLQELPAERRTDAVSSMVYEANARLRDPVYGCAGIAFQMQSQLCQLQSQ 107
                       7******************************************************************************************** PP

            DUF260  94 lallkee 100
                       la++++e
  MA_10434193g0010 108 LATAQAE 114
                       ***9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.20914115IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-4115112IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MASIVGGFRA HTPSPCAACK MLRRRCGEKC VFAPYFPSND LHKFVTVHRI FGASNIIKLL  60
QELPAERRTD AVSSMVYEAN ARLRDPVYGC AGIAFQMQSQ LCQLQSQLAT AQAEILTMRL  120
QQANLLALIT GSSDSGETPR PLSPSGSAVS QESNDQQTDL IYFEGEDPLQ LWDDSVWTQL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-391411610112LOB family transfactor Ramosa2.1
5ly0_B5e-391411610112LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF0845570.0EF084557.1 Picea sitchensis clone WS0271_N08 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019227600.13e-61PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR05e-55LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA9NTB01e-110A9NTB0_PICSI; Uncharacterized protein
STRINGGLYMA15G05030.11e-58(Glycine max)
STRINGGSMUA_Achr7P15500_0013e-58(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.12e-48LOB domain-containing protein 1