PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_10433499g0020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family Trihelix
Protein Properties Length: 733aa    MW: 82702.4 Da    PI: 7.688
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_10433499g0020genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix52.81.1e-16184247265
          trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkik 65 
                       W  +e++ L+++r+em+ ++r+++l++  We+vs+k++e g++rs++ Ck+k+e++n    k k
  MA_10433499g0020 184 WATEETQNLLRIRSEMHLKFRDSNLQAVAWEDVSRKLAELGYRRSAQACKKKIEQVNLTSDKAK 247
                       ******************************************************9986655555 PP

2trihelix96.62.3e-30417502186
          trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergf.erspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                       rW+k ev+aLi++r+++e ++++   k+plW+e+s  m++ gf +rs+k+Ckekwen+nk+++k+k+++kkr +e+ +tcpyf+ql+
  MA_10433499g0020 417 RWPKPEVQALIRLRSNLEPKFQEPGPKGPLWQEISTGMASLGFtNRSAKRCKEKWENINKYFRKTKDSMKKR-PENAKTCPYFHQLD 502
                       8******************************************99**************************8.99999*******97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.133176240IPR017877Myb-like domain
SMARTSM007176.7180242IPR001005SANT/Myb domain
PfamPF138371.9E-12183249No hitNo description
CDDcd122036.23E-15184240No hitNo description
SMARTSM007171.2E-4414477IPR001005SANT/Myb domain
CDDcd122035.00E-28416482No hitNo description
PfamPF138372.0E-20416503No hitNo description
PROSITE profilePS500907.352417475IPR017877Myb-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 733 aa     Download sequence    Send to blast
MLNRDWAVAT ACRAPSGRRR HHAQLHSRML LPSSALFEIV RATERGRTGT EVAGLAPGHT  60
KLPSLLKCGR AHSYSEGRRN AVRRAVWHSR HPAAYDGERS ASADVCSFPR YAVTPHEAPR  120
LASSFDSSLF HTFPSGSPLP ALVGHSSCIA AGDARADRTA IQAETEDDDD GIEGEDDEDN  180
DDGWATEETQ NLLRIRSEMH LKFRDSNLQA VAWEDVSRKL AELGYRRSAQ ACKKKIEQVN  240
LTSDKAKDGK SFMLFGELEA VCNGGSRVNN GGATNAALPE EVPAKPEQQN KKKRKRKHLA  300
SIKLFLENLV KQLLENQEAL HGKFLEAIER RDQERINREE AWKRQEMARL TRETELRAQE  360
YALASTREAA IVAFLQKITG QDLKLPEAPV PSHATETQED HQISCMDKDL SDPNGKRWPK  420
PEVQALIRLR SNLEPKFQEP GPKGPLWQEI STGMASLGFT NRSAKRCKEK WENINKYFRK  480
TKDSMKKRPE NAKTCPYFHQ LDVLYRKGIL SSPNKCNRVD QNSNSSDAML EDQGHGHDSN  540
HKDDLHEHIQ ASCSDSEHII SVMPAEAEEI TPANDNDNVY FFRSPDPVDH GHQMTKLKKI  600
LPANNHKTPN SASPNVESGT TTRNTGVFST DNNKTALVME RMAKDMLEAQ QQQQKKLLEE  660
FERREQNQNQ HLHQHQQHQE LRDQEEFRCQ QNELKFIQER SQSATQSALM ALVDKLTAEI  720
AGGYSIPVPS AKR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1290296KKKRKRK
2291296KKRKRK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1117310.0BT111731.1 Picea glauca clone GQ03302_O03 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0C9S5C51e-139A0A0C9S5C5_9SPER; TSA: Wollemia nobilis Ref_Wollemi_Transcript_12946_2942 transcribed RNA sequence
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6631573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.11e-61Trihelix family protein