PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_10431460g0020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family ARF
Protein Properties Length: 373aa    MW: 41893.8 Da    PI: 7.8733
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_10431460g0020genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B373.82e-23152253199
                       EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
                B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                       f+k+lt sd++ +g +++p++ ae++      ++++ s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv+ ++L +gD ++F   +++
  MA_10431460g0020 152 FCKTLTVSDTSIHGGFSVPRRAAEDCfppldYKQERPSQELVAKDLHGVVWKFRHIYRGQPRRHLLTTGWSVFVSHKRLVSGDAILFL--RDE 242
                       99****************************8444556789************************************************..568 PP

                       EE..EEEEE-S CS
                B3  89 efelvvkvfrk 99 
                       ++el+++++r+
  MA_10431460g0020 243 NGELRLGIRRA 253
                       9999****997 PP

2Auxin_resp128.34.7e-42278360183
        Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                       aaha++tks+F+++YnPr+s++eFvv+++k++k++++++s+GmRfkm+feted++err+ Gt++g+ d++p+rWp SkWrsLk
  MA_10431460g0020 278 AAHAVATKSMFHIFYNPRTSPAEFVVPYHKYVKSFNQPISIGMRFKMRFETEDAAERRYIGTITGIGDAEPSRWPSSKWRSLK 360
                       79*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.88E-44149281IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.107.0E-41149267IPR015300DNA-binding pseudobarrel domain
CDDcd100171.37E-22150252No hitNo description
PROSITE profilePS5086312.915152254IPR003340B3 DNA binding domain
SMARTSM010196.4E-23152254IPR003340B3 DNA binding domain
PfamPF023622.7E-21152253IPR003340B3 DNA binding domain
PfamPF065075.8E-38278360IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0010050Biological Processvegetative phase change
GO:0010158Biological Processabaxial cell fate specification
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MERGARRAGW NSSWFMEIAD LVSRDGFKPL AAENGGNGEM AVPICSELWH ASAGPLTSLP  60
AKGSYVVYFP QGHMEQVAAF LDQDTDQQMP SYNIPTQIFC RVLCVKLHAD QETDEVYAQL  120
TLVPVPEPTA KSLEEEEEQQ VHTSGTCIPH MFCKTLTVSD TSIHGGFSVP RRAAEDCFPP  180
LDYKQERPSQ ELVAKDLHGV VWKFRHIYRG QPRRHLLTTG WSVFVSHKRL VSGDAILFLR  240
DENGELRLGI RRATRQQCVI PSSVLSSQNM HLGLLAAAAH AVATKSMFHI FYNPRTSPAE  300
FVVPYHKYVK SFNQPISIGM RFKMRFETED AAERRYIGTI TGIGDAEPSR WPSSKWRSLK  360
TISEVGLGTP KFI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-135303601332Auxin response factor 1
4ldw_A1e-135303601332Auxin response factor 1
4ldw_B1e-135303601332Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020526714.11e-151auxin response factor 4 isoform X3
RefseqXP_020526715.11e-151auxin response factor 4 isoform X4
SwissprotQ9ZTX91e-138ARFD_ARATH; Auxin response factor 4
TrEMBLD4HTT81e-169D4HTT8_GINBI; Auxin response factor
STRINGAquca_027_00067.11e-150(Aquilegia coerulea)
STRINGEFJ335381e-150(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP10049811
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60450.11e-137auxin response factor 4
Publications ? help Back to Top
  1. Ozerova LV,Krasnikova MS,Troitsky AV,Solovyev AG,Morozov SY
    TAS3 Genes for small ta-siARF RNAs in plants belonging to subtribe Senecioninae: occurrence of prematurely terminated RNA precursors.
    Mol. Gen. Mikrobiol. Virusol., 2013.
    [PMID:24003511]
  2. Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
    The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
    Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
    [PMID:26108442]
  3. Pashkovskiy PP,Kartashov AV,Zlobin IE,Pogosyan SI,Kuznetsov VV
    Blue light alters miR167 expression and microRNA-targeted auxin response factor genes in Arabidopsis thaliana plants.
    Plant Physiol. Biochem., 2016. 104: p. 146-54
    [PMID:27031426]
  4. Matsumura Y, et al.
    A genetic link between epigenetic repressor AS1-AS2 and a putative small subunit processome in leaf polarity establishment of Arabidopsis.
    Biol Open, 2016. 5(7): p. 942-54
    [PMID:27334696]
  5. Guan C, et al.
    Spatial Auxin Signaling Controls Leaf Flattening in Arabidopsis.
    Curr. Biol., 2017. 27(19): p. 2940-2950.e4
    [PMID:28943086]
  6. Liu Z, et al.
    ARF2-ARF4 and ARF5 are Essential for Female and Male Gametophyte Development in Arabidopsis.
    Plant Cell Physiol., 2018. 59(1): p. 179-189
    [PMID:29145642]