PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_10430831g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family GRAS
Protein Properties Length: 451aa    MW: 49537.5 Da    PI: 6.405
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_10430831g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS435.34.7e-133824492374
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdg.dpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                       v+lL+ cAea++ +dl+ a+ ++ +++ +++++   +m ++a++f+eAL +r+ +  ++  ++l+         +++   ++ f+ev+P+lkf
  MA_10430831g0010  82 VHLLMGCAEAIQRNDLKVASDMVREIRMTVNSSPcGAMGKVASHFVEALTRRICG-LNGAESILSQA------DAQSEILYQHFYEVCPYLKF 167
                       89**************************95555559******************9.33333333322......2344457899********** PP

              GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrl 186
                       +h+taNqaIlea+eg+  vH+iD+++++GlQWpaL+qaLa Rp+gpp lR+T++g+ +++ ++ l+e+g +La++A++++v+f+f+ ++a++l
  MA_10430831g0010 168 AHFTANQAILEAFEGHGSVHVIDLNLMHGLQWPALIQALALRPGGPPLLRLTAIGPRQPDGRDVLQEIGMKLAQLADSVNVEFDFRGVMADKL 260
                       ********************************************************************************************* PP

              GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsles.erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpre 278
                       ed+++++++vkpgE++aVn+vlqlhrll  ++++ s ++d vLk + sl+Pk+v+vve+ea+hn++ Fl+rf+eal+yys++fdslea     
  MA_10430831g0010 261 EDIKPWMFQVKPGEVIAVNSVLQLHRLLYIDAPTGSsPIDVVLKSIGSLRPKIVTVVEHEANHNGPHFLDRFVEALHYYSTMFDSLEACNVLP 353
                       ****************************9999888779************************************************6654455 PP

              GRAS 279 seerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvS 371
                       ++ ++ + + ++++ei+n+vaceg++r+erhetl++Wr+rl++aGF++ +l+++a  qa++ll  ++++gy+vee +gsl+lgW++rpL+++S
  MA_10430831g0010 354 NSIEKLLAELYIQKEICNIVACEGRDRIERHETLSHWRMRLSRAGFRQSHLGSNAFRQASMLLTLFSGEGYTVEETNGSLTLGWHSRPLIAAS 446
                       55556666677********************************************************************************** PP

              GRAS 372 aWr 374
                       aW+
  MA_10430831g0010 447 AWQ 449
                       **6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.34455429IPR005202Transcription factor GRAS
PfamPF035141.6E-13082449IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006808Biological Processregulation of nitrogen utilization
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0010218Biological Processresponse to far red light
GO:0010233Biological Processphloem transport
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 451 aa     Download sequence    Send to blast
MPPMILGKPA EATAGDSDPS VRCNIYSGLP LRSGDSSTLP SFQAQSFSTQ SSDEGSSLSS  60
TRRGTAQQAM DNGAQESGIR VVHLLMGCAE AIQRNDLKVA SDMVREIRMT VNSSPCGAMG  120
KVASHFVEAL TRRICGLNGA ESILSQADAQ SEILYQHFYE VCPYLKFAHF TANQAILEAF  180
EGHGSVHVID LNLMHGLQWP ALIQALALRP GGPPLLRLTA IGPRQPDGRD VLQEIGMKLA  240
QLADSVNVEF DFRGVMADKL EDIKPWMFQV KPGEVIAVNS VLQLHRLLYI DAPTGSSPID  300
VVLKSIGSLR PKIVTVVEHE ANHNGPHFLD RFVEALHYYS TMFDSLEACN VLPNSIEKLL  360
AELYIQKEIC NIVACEGRDR IERHETLSHW RMRLSRAGFR QSHLGSNAFR QASMLLTLFS  420
GEGYTVEETN GSLTLGWHSR PLIAASAWQG F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-4912144942375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ1589860.0KJ158986.1 Pinus tabuliformis RGA mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012444908.11e-180PREDICTED: DELLA protein SLR1-like
SwissprotQ8S4W71e-154GAI1_VITVI; DELLA protein GAI1
TrEMBLX5CYB60.0X5CYB6_PINTB; RGA
STRINGVIT_11s0016g04630.t011e-174(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12511550
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.11e-139GRAS family protein