PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_10430774g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family B3
Protein Properties Length: 851aa    MW: 95132.6 Da    PI: 10.0675
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_10430774g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B349.57.9e-162771899
                      --HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                B3 18 lpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                      +p  f+ +  ++ ++   ++le +s+++W+vkl  + +s ++ ++kGW++Fv +++L+ gDf+vFk++++s f  +v++f +
  MA_10430774g0010  2 IPPAFVGKLRNQANG--NVILEGPSSQRWSVKL--CYTSVGMEFQKGWEKFVCDHRLELGDFLVFKYTSKSYF--TVQIFGR 77
                      888999888766555..6***************..777777779***********************987888..9999976 PP

2B356.74.5e-18243334498
                       E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
                B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                       v++ps+v +  +l lpk+  + ++++k +  ++tl  + +++W v++   + +gr  l++GWk+F+ +n+L+egD+++F+l+++++ +++v +
  MA_10430774g0010 243 VMKPSHVYQGFWLALPKRLGNCFQLPK-GRYQVTLLGPANKEWVVQY--IGDRGRAGLSGGWKHFAIDNNLEEGDVCIFELVNKNKYTFKVYI 332
                       789****************96668886.557****************..88888888************************998999999999 PP

                       E- CS
                B3  97 fr 98 
                       fr
  MA_10430774g0010 333 FR 334
                       98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.9E-19180IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.2E-19180IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086315.213178IPR003340B3 DNA binding domain
CDDcd100171.14E-15175No hitNo description
PfamPF023623.0E-13277IPR003340B3 DNA binding domain
SMARTSM010191.7E-4678IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.8E-20232334IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.65E-23235336IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.451240336IPR003340B3 DNA binding domain
SMARTSM010192.7E-17240336IPR003340B3 DNA binding domain
PfamPF023621.6E-17242334IPR003340B3 DNA binding domain
CDDcd100173.06E-23243334No hitNo description
Gene3DG3DSA:2.40.330.103.0E-8580650IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.65E-10583650IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508636.104588650IPR003340B3 DNA binding domain
CDDcd100171.36E-10591650No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009909Biological Processregulation of flower development
GO:0010048Biological Processvernalization response
GO:0005654Cellular Componentnucleoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 851 aa     Download sequence    Send to blast
RIPPAFVGKL RNQANGNVIL EGPSSQRWSV KLCYTSVGME FQKGWEKFVC DHRLELGDFL  60
VFKYTSKSYF TVQIFGRSGC EKRNVFNMKN FGASLLSLEE KANRDAQDNF PDTLVKSFDA  120
DRYQVVPNHT NSQMPVILYT DEDSNDRAMG TFKFKQSVSE TCPDSAKHPC HGIAARTIKN  180
TESCQPSFAG KKHAIVTSAE TGGKSYMQAY YVSCRRAVTE AERNRALKAA NSFKSNKPLA  240
LIVMKPSHVY QGFWLALPKR LGNCFQLPKG RYQVTLLGPA NKEWVVQYIG DRGRAGLSGG  300
WKHFAIDNNL EEGDVCIFEL VNKNKYTFKV YIFRVIKNCI PCKRMEGTKL NEKNGRGRKS  360
IALPSLSLGE KANCGAQNKC PDTLVNSSDA DQNQIVAKCT NSKLLISLDS DEELDDQEMA  420
THKFEQSVAE TSLNHAEPGC CGIAARTVMN TESCQPSFAG KKCKMVTSAE NKGKKCKIVT  480
CAENEGKKHK IITSAENKRK KRKIVTSAEN EGKKRKIVTS AENKGKKGKI VTSAENEGKK  540
GKIVTSTENE GKSYLGIYYV SCRRAVTQAE RKKALETANS FKSSKPFSLL IMTPSHVYQG  600
FYLSFPRRFE ACFQLPRERM EVTLLGPTNK EWQVQYLGDR SHPGLSGGWR VVKKCTPFKK  660
MEGTKVNDKD VQCRKIIADP VNHFKKMKVS TMSTKKIATN SAVPASGRRI PDILEQGIVP  720
KKEEKQVRKK KDHSSSPNNI IEMDKSSWDS RIDRRSSPRF NRVCNSSEHP KQLSRPAFTN  780
RKRTIDSDTV LLSAKTNAQL DDTNGEADLI IISDSNDVAG PSSIIPSQES IHERPSLTKS  840
NVQVVKQENQ A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A2e-2021533524142B3 domain-containing transcription factor VRN1
4i1k_B2e-2021533524142B3 domain-containing transcription factor VRN1
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1500515KRKIVTSAENEGKKRK
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP20511436
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.15e-31B3 family protein