PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_10429262g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family LBD
Protein Properties Length: 218aa    MW: 23623.6 Da    PI: 6.6161
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_10429262g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260145.61.4e-4591081100
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       +CaaCk+lrrkC+++Cv+apyfp e+p+kfanvhk+FGasnv+k+l++l++++reda++sl+yeAear++dPvyG+vg i+ lq+q++ql++e
  MA_10429262g0010   9 PCAACKFLRRKCTSECVFAPYFPPEEPQKFANVHKIFGASNVTKILNDLEPHQREDAVNSLAYEAEARLKDPVYGCVGAISILQRQVQQLQKE 101
                       7******************************************************************************************** PP

            DUF260  94 lallkee 100
                       la++++ 
  MA_10429262g0010 102 LAAAHAD 108
                       **99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.9288109IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-449106IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MASTSSNSPC AACKFLRRKC TSECVFAPYF PPEEPQKFAN VHKIFGASNV TKILNDLEPH  60
QREDAVNSLA YEAEARLKDP VYGCVGAISI LQRQVQQLQK ELAAAHADLL QYTSAAEPVL  120
NPHSPGSTLP TYSRFQMIHS AATEQQQQNL VEFPNSRELQ LTREQLLELA LRIGGSYEAG  180
LAALGMTNHA YALYPSPRPA SDGGSGSSGC SFGHLSSP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-6231125114LOB family transfactor Ramosa2.1
5ly0_B2e-6231125114LOB family transfactor Ramosa2.1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00581DAPTransfer from AT5G63090Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ1044571e-148FJ104457.2 Pinus taeda isolate 2080 anonymous locus 2_8995_01 genomic sequence.
GenBankFJ1044581e-148FJ104458.2 Pinus taeda isolate 2084 anonymous locus 2_8995_01 genomic sequence.
GenBankFJ1044591e-148FJ104459.1 Pinus taeda isolate 2082 anonymous locus 2_8995_01 genomic sequence.
GenBankFJ1044601e-148FJ104460.2 Pinus taeda isolate 2090 anonymous locus 2_8995_01 genomic sequence.
GenBankFJ1044611e-148FJ104461.2 Pinus taeda isolate 2094 anonymous locus 2_8995_01 genomic sequence.
GenBankFJ1044621e-148FJ104462.2 Pinus taeda isolate 2085 anonymous locus 2_8995_01 genomic sequence.
GenBankFJ1044631e-148FJ104463.1 Pinus taeda isolate 2087 anonymous locus 2_8995_01 genomic sequence.
GenBankFJ1044641e-148FJ104464.2 Pinus taeda isolate 2093 anonymous locus 2_8995_01 genomic sequence.
GenBankFJ1044651e-148FJ104465.2 Pinus taeda isolate 2088 anonymous locus 2_8995_01 genomic sequence.
GenBankFJ1044661e-148FJ104466.2 Pinus taeda isolate 2081 anonymous locus 2_8995_01 genomic sequence.
GenBankFJ1044671e-148FJ104467.2 Pinus taeda isolate 2092 anonymous locus 2_8995_01 genomic sequence.
GenBankFJ1044681e-148FJ104468.2 Pinus taeda isolate 2086 anonymous locus 2_8995_01 genomic sequence.
GenBankFJ1044691e-148FJ104469.1 Pinus taeda isolate 2095 anonymous locus 2_8995_01 genomic sequence.
GenBankFJ1044701e-148FJ104470.1 Pinus taeda isolate 2091 anonymous locus 2_8995_01 genomic sequence.
GenBankFJ1044711e-148FJ104471.1 Pinus taeda isolate 2089 anonymous locus 2_8995_01 genomic sequence.
GenBankFJ1044721e-148FJ104472.2 Pinus taeda isolate 2096 anonymous locus 2_8995_01 genomic sequence.
GenBankFJ1044731e-148FJ104473.2 Pinus taeda isolate 2083 anonymous locus 2_8995_01 genomic sequence.
GenBankFJ1044741e-148FJ104474.2 Pinus taeda isolate 2079 anonymous locus 2_8995_01 genomic sequence.
GenBankJQ2629181e-148JQ262918.1 Pinus radiata isolate 2097 hypothetical protein (2_8995_01) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024403438.17e-69LOB domain-containing protein 6-like
SwissprotQ8L8Q33e-63LBD25_ARATH; LOB domain-containing protein 25
TrEMBLH9X0F36e-82H9X0F3_PINTA; Uncharacterized protein (Fragment)
STRINGPP1S170_78V6.13e-68(Physcomitrella patens)
STRINGPP1S170_93V6.16e-68(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.11e-65LOB domain-containing protein 25
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]