PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_10429213g0020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family M-type_MADS
Protein Properties Length: 338aa    MW: 38566 Da    PI: 6.9986
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_10429213g0020genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF44.32.3e-1477114643
                       HHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
            SRF-TF   6 ksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43 
                       ++ r+ tf kR++g+ KK eELS+LC++e++++ f+++
  MA_10429213g0020  77 DTSRNMTFMKRKKGLKKKVEELSILCGVEACMVCFGPQ 114
                       57899******************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.2E-463123IPR002100Transcription factor, MADS-box
PfamPF003193.4E-1577114IPR002100Transcription factor, MADS-box
PROSITE profilePS5006612.30677112IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.84E-1777165IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MQPSTSAFSP ASQSINLMAL MALTTAYPPI SLLGSSIVFW QLPAQRGCYR ALDELALTFA  60
PVMPRLRGQP RRGDGXDTSR NMTFMKRKKG LKKKVEELSI LCGVEACMVC FGPQMDQQTA  120
SDHPDVWPGK SKALEIVERY RSLSKEEQEK KKLDNSNFLE QRIKKLKVEL SIKRKENREL  180
EMESVYPWDS CLNFFTDEQL KDLVDYIDIR LETVHDRINF LSRHEREIYN GAESDMVPLR  240
ELECIARQPM EDGGSYNFMM PYQSGGESLN SVVGQVKPYL GLEGHYKALM SSCGTVAMDY  300
YSKVNPLFIA ALKDYHAPNS KEESSRVLRY QEFMGLLS
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1245670.0BT124567.1 Picea sitchensis clone WS0475_C11 unknown mRNA.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP11413173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.15e-16AGAMOUS-like 80