PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_10427464g0040
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family SBP
Protein Properties Length: 448aa    MW: 49701.3 Da    PI: 10.4521
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_10427464g0040genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP123.77.7e-39217294178
                       --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
               SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                       +Cqv++C++dl++ak+yhr+hkvCe+hska+++lv  l+qrfCqqCsrfh l+efDe+krsCrrrL +hn+rrrk+q 
  MA_10427464g0040 217 MCQVDDCRTDLTSAKDYHRHHKVCETHSKASKALVGSLMQRFCQQCSRFHPLQEFDEGKRSCRRRLVGHNRRRRKTQR 294
                       6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.5E-33210279IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.248215292IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.7E-36216295IPR004333Transcription factor, SBP-box
PfamPF031106.8E-29218291IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 448 aa     Download sequence    Send to blast
MIQARSVPLL RKSTAAKSIG IQRVSAFTFC LLKMDGKAGP QVASPFFQHQ LLSGPLYEPP  60
LAAKRCVEPT NSSWTRTNWQ HQQQQKTLPV YEVSKPNWNA NLWDWDSVRF VAKPVNLGNH  120
HEPSNRNIKP QVSSKILRLG SNDAGLNVVN ASSLPDQKRK LDEPVKPFLP SKDSSENDPG  180
NLTLKLGGSS YSYADDTNAS RQNKRVRSGS SGSSYPMCQV DDCRTDLTSA KDYHRHHKVC  240
ETHSKASKAL VGSLMQRFCQ QCSRFHPLQE FDEGKRSCRR RLVGHNRRRR KTQRDEALPW  300
GLLAASQENG GFGNLDIVSL VSILSRLQGN NNSIEKPSGQ SSLDGDQVIQ LLNRMNSVFP  360
SSQKVVAPSQ GFDLNIAQSI QSPRADIPKE NGNPSGGLTA ELLAILSALT GPSHDALALL  420
RNSLXXXXKW FFKVLFSMAL ARKRHELA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-33209291184squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006849915.11e-92squamosa promoter-binding-like protein 14
TrEMBLA0A0C9S2R61e-157A0A0C9S2R6_9SPER; TSA: Wollemia nobilis Ref_Wollemi_Transcript_18703_5262 transcribed RNA sequence
STRINGERN114966e-92(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.19e-55squamosa promoter binding protein-like 14