PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_10427464g0020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family SBP
Protein Properties Length: 388aa    MW: 42301.9 Da    PI: 9.7676
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_10427464g0020genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP28.73.4e-09173218146
                       --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTT CS
               SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqC 46 
                       +Cqv++C++dl++ak+yhrrhk  +   k p+  +  l + f    
  MA_10427464g0020 173 MCQVDDCRTDLTSAKDYHRRHKYVKPIPKLPKHSLGALCNAFVSSA 218
                       6*********************999988888877777766666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.2E-9166197IPR004333Transcription factor, SBP-box
PROSITE profilePS5114110.366171248IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.29E-9172220IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MGCADCDDRF PLRTGQGLCR TVANRKFRRA ELGLLKMDGK AGPQVASPFX XYEPPLAAKR  60
CVEPADSAWT RTNWQHQQQQ KNPPVYEVSK PNWNANLWDW DSGRFVAKPL PDQKRKLDEP  120
VKIFLPGKDS SENDPGNLTL KLGGSSYSYA DDTNASRQNK RVRSGSPGSS YPMCQVDDCR  180
TDLTSAKDYH RRHKYVKPIP KLPKHSLGAL CNAFVSSAAD FIRFKNLMRG REAVDGDSRG  240
TIGEGGKPSQ MKHCPGDXNN NSMEKPSGQS SLDGDQVIQL LNRMNSAFPS SQKVAAPSQG  300
FDLNIAQSIR SPRADIPKAN GNPSAGLTAE LLAIFSALTG PSHDALALLR NSLATNLNAN  360
LKPQHQTLPP PAPAPAPAAA QKPQERDI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0C9S2R64e-86A0A0C9S2R6_9SPER; TSA: Wollemia nobilis Ref_Wollemi_Transcript_18703_5262 transcribed RNA sequence
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.11e-25squamosa promoter binding protein-like 14