PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_10366239g0020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family NF-YA
Protein Properties Length: 318aa    MW: 36213.1 Da    PI: 10.4157
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_10366239g0020genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA29.42.7e-09120151436
         CBFB_NFYA   4 lYVNaKQyqrIlkRRqkRakleeekkldeksrk 36 
                       ++VNaKQy++IlkRR +R k e+++k    +r 
  MA_10366239g0020 120 VWVNAKQYRGILKRRLARLKWEQTRKK-RSQRE 151
                       79*********************8886.33333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS511529.242116183IPR001289Nuclear transcription factor Y subunit A
PfamPF020456.1E-8120151IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MRPPPPNDLT GKVYGGTRTG TGTRDRDSGL ILRDSGQGQW ANKGQGQWSN KDSEQSNKFS  60
AVRPTDSEGL SIKQRVSFWA ETLISPNSIM TMGQKTLEPV ETNDIGQVKI ASSAKTGKWV  120
WVNAKQYRGI LKRRLARLKW EQTRKKRSQR ESTWVLRKKQ HSNKSSLQVC GNKSKEKGKV  180
SDDYALYSLT STLLTWSFDL YVKELLKVKE RLEVVEAKEL ERDYTIHRII AESQDLAESN  240
KVMKEQVSLL QEALQMGKTE WQRMKAEVQN MKKIAVENTE VMSAKPSQDK GKVVTQIDNN  300
EETSREERKG DSTKLSKT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1131146KRRLARLKWEQTRKKR