PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_10322870g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family NF-YA
Protein Properties Length: 256aa    MW: 29684.9 Da    PI: 10.2226
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_10322870g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA28.64.6e-092960436
         CBFB_NFYA  4 lYVNaKQyqrIlkRRqkRakleeekkldeksrk 36
                      ++VNaKQy++IlkRR +R k e+++k    +r 
  MA_10322870g0010 29 VWVNAKQYRGILKRRLARLKREQTRKK-RSQRE 60
                      89*********************8886.33333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5115210.8652593IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.0E-72968IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MGQETLEPVE TNDIGQVKIA SSAKTEKWVW VNAKQYRGIL KRRLARLKRE QTRKKRSQRE  60
STWVLRKKQH SNKSSLQVCG NKSKGKGKVI DDYALYSPTY TPLTWSSDLY VKELLKVKER  120
LEVVEAKELE IDCTIHRIIA ENQDLAENNK VLKEQVSLLQ EALRMGKTEW QRMKAEVKNM  180
KKIVVENTEV MNAKPSQDKG KVVTQIDNNE ETSREERKGD SAKLSKTWAQ IISNLAKREG  240
ERNIQVDNMQ DRESKE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14055KRRLARLKREQTRKKR