PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_27539A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family TCP
Protein Properties Length: 250aa    MW: 26508.2 Da    PI: 10.256
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_27539AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP62.61.5e-194790346
                        TCP  3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsk 46
                               g+kdrhsk+ T +g+RdRRvRls+++a++++dLqd+LG+ ++sk
  Oropetium_20150105_27539A 47 GGKDRHSKVRTVKGLRDRRVRLSVPTAIQLYDLQDRLGLSQPSK 90
                               78*****************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136917.00648106IPR017887Transcription factor TCP subgroup
PfamPF036345.5E-184890IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MISGNHTNEE LARCRKAEQQ PGAAVASSRH WPPSTESRIV RVSRVFGGKD RHSKVRTVKG  60
LRDRRVRLSV PTAIQLYDLQ DRLGLSQPSK FPPTHAQDLV XXXXXXXXXX FASAASAAVL  120
DGDKSVGGSI KGLMGLNNSV NGLVNGGAMP LAHGLFFAGG ESWTSGGGSV HDQVSHGNSP  180
QQPTVAHHSP FSSLLSLAPR PQLVFYSPEG GAFAMKEAPD QFPVDNLEHS QGLLSLSSAR  240
SFLHSGSQG*
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_27539A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9689089e-80EU968908.1 Zea mays clone 324906 TCP family transcription factor containing protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961521.11e-108transcription factor TCP13 isoform X1
RefseqXP_004961522.11e-108transcription factor TCP13 isoform X1
RefseqXP_012700333.11e-108transcription factor TCP13 isoform X1
TrEMBLK3Z8G31e-107K3Z8G3_SETIT; Uncharacterized protein
STRINGSi022830m1e-108(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24903584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02150.19e-28plastid transcription factor 1