PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_27090A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family bZIP
Protein Properties Length: 326aa    MW: 34797.3 Da    PI: 10.4683
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_27090AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_125.72.5e-08141178542
                                CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                     bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeN 42 
                                k+++r + NR +A rs +RK  +i eLe+kv+ ++ e 
  Oropetium_20150105_27090A 141 KKAKRIINNRQSAARSKERKMRYISELERKVQFMQREA 178
                                89*****************************9877775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.7E-4137215IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.611139177IPR004827Basic-leucine zipper domain
PfamPF001701.0E-7141181IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.58E-9141184No hitNo description
Gene3DG3DSA:1.20.5.1703.3E-8141182No hitNo description
CDDcd147038.69E-17142183No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MNQSPIPGGC DGGDTAGGGG GGNGLPRRPR RRAVAFFGRK REELFSMFIN VDKLNSPGGV  60
SESESSCAMT GAGGGEATQM SAAALGAGAK PRHHHSHSMD ASSSITTEIC LGRRRWRGCP  120
RQRPGRQCAA KLAELALIDP KKAKRIINNR QSAARSKERK MRYISELERK VQFMQREATD  180
YQPSCTGCRC AKTFSIRDTA GLSAENSELK IRLQNTENQV HLQDALNDAL KSELQRLKVA  240
TGQMGNGGGG MMNFGPFGAN QPMFHGNQQA MQPFLAMQQL PNAPFLPPQQ LPQAALGLNM  300
RGGPASGAAP SQLSWGEAWS ESSSG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12631RRPRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004974066.11e-105PREDICTED: transcription factor RF2a-like
TrEMBLK3YMV41e-105K3YMV4_SETIT; Uncharacterized protein
STRINGSi015587m1e-104(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42693868
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31370.51e-46bZIP family protein